HBB Antibody - N-terminal region (ARP87237_P050)

Catalog No: ARP87237_P050

Host: Rabbit
Target Name: HBB
Sample Tissue: Human Mesenchymoma Tumor lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HBB
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: VHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLST
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-HBB (ARP87237_P050) antibody is Catalog # AAP87237

Target Info

• Gene Symbol: HBB
• Gene Full Name: hemoglobin subunit beta
• Alias Symbols: ECYT6, CD113t-C, beta-globin
• NCBI Gene Id: 3043
• Protein Name: hemoglobin subunit beta
• Description of Target: The alpha (HBA) and beta (HBB) loci determine the structure of the 2 types of polypeptide chains in adult hemoglobin, Hb A. The normal adult hemoglobin tetramer consists of two alpha chains and two beta chains. Mutant beta globin causes sickle cell anemia. Absence of beta chain causes beta-zero-thalassemia. Reduced amounts of detectable beta globin causes beta-plus-thalassemia. The order of the genes in the beta-globin cluster is 5'-epsilon -- gamma-G -- gamma-A -- delta -- beta--3'. 
• Uniprot ID: P68871
• Protein Accession #: NP_000509.1
• Nucleotide Accession #: NM_000518.4
• Protein Size (# AA): 147
• Molecular Weight: 16 kDa