Search Antibody, Protein, and ELISA Kit Solutions

HAVCR1 Antibody - middle region (ARP90589_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
HAVCR1
Official Gene Full Name:
hepatitis A virus cellular receptor 1
NCBI Gene Id:
171283
Protein Name:
hepatitis A virus cellular receptor 1 homolog
Swissprot Id:
Q5QNS5
Protein Accession #:
NP_001160103.1
Nucleotide Accession #:
NM_001166631.1
Alias Symbols:
Tim1, KIM-1, TIM-1, Timd1, AI503787
Description of Target:
May play a role in T-helper cell development and the regulation of asthma and allergic diseases. Receptor for TIMD4. May play a role in kidney injury and repair (By similarity).
Protein Size (# AA):
305
Molecular Weight:
33 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HAVCR1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HAVCR1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of mouse HAVCR1
Predicted Species Reactivity:
Mouse
Peptide Sequence:
Synthetic peptide located within the following region: SRYNLKGHISEGDVSLTIENSVESDSGLYCCRVEIPGWFNDQKVTFSLQV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-HAVCR1 (ARP90589_P050) antibody is Catalog # AAP90589
Datasheets/Manuals:
Printable datasheet for anti-HAVCR1 (ARP90589_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...