Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP59892_P050-FITC Conjugated

ARP59892_P050-HRP Conjugated

ARP59892_P050-Biotin Conjugated

HAUS8 Antibody - N-terminal region (ARP59892_P050)

Catalog#: ARP59892_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human, Pig
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-240745 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human HAUS8
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Human: 100%; Pig: 75%
Complete computational species homology data Anti-HAUS8 (ARP59892_P050)
Peptide Sequence Synthetic peptide located within the following region: QTRGKMSEGGRKSSLLQKSKADSSGVGKGDLQSTLLEGHGTAPPDLDLSA
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-HAUS8 (ARP59892_P050) antibody is Catalog # AAP59892 (Previous Catalog # AAPP46051)
Datasheets/Manuals Printable datasheet for anti-HAUS8 (ARP59892_P050) antibody
Subunit 8
Gene Symbol HAUS8
Official Gene Full Name HAUS augmin-like complex, subunit 8
Alias Symbols HICE1, MGC20533, NY-SAR-48, DGT4
NCBI Gene Id 93323
Protein Name HAUS augmin-like complex subunit 8
Description of Target HAUS8 is 1 of 8 subunits of the 390-kD human augmin complex, or HAUS complex. The augmin complex was first identified in Drosophila, and its name comes from the Latin verb 'augmentare,' meaning 'to increase.' The augmin complex is a microtubule-binding complex involved in microtubule generation within the mitotic spindle and is vital to mitotic spindle assembly (Goshima et al., 2008 [PubMed 18443220]; Uehara et al., 2009 [PubMed 19369198]).
Swissprot Id Q9BT25
Protein Accession # NP_219485
Nucleotide Accession # NM_033417
Protein Size (# AA) 410
Molecular Weight 45kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express HAUS8.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express HAUS8.
Protein Interactions UBC; APP; HAUS6; HAUS5; Haus4; Haus1; Haus2; Plk1;
  1. What is the species homology for "HAUS8 Antibody - N-terminal region (ARP59892_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Pig".

  2. How long will it take to receive "HAUS8 Antibody - N-terminal region (ARP59892_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HAUS8 Antibody - N-terminal region (ARP59892_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "HAUS8 Antibody - N-terminal region (ARP59892_P050)"?

    This target may also be called "HICE1, MGC20533, NY-SAR-48, DGT4" in publications.

  5. What is the shipping cost for "HAUS8 Antibody - N-terminal region (ARP59892_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HAUS8 Antibody - N-terminal region (ARP59892_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HAUS8 Antibody - N-terminal region (ARP59892_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "45kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HAUS8 Antibody - N-terminal region (ARP59892_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "HAUS8"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HAUS8"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HAUS8"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HAUS8"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HAUS8"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HAUS8"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HAUS8 Antibody - N-terminal region (ARP59892_P050)
Your Rating