Search Antibody, Protein, and ELISA Kit Solutions

HAUS8 Antibody - N-terminal region (ARP59892_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP59892_P050-FITC Conjugated

ARP59892_P050-HRP Conjugated

ARP59892_P050-Biotin Conjugated

Gene Symbol:
HAUS8
Official Gene Full Name:
HAUS augmin-like complex, subunit 8
NCBI Gene Id:
93323
Protein Name:
HAUS augmin-like complex subunit 8
Swissprot Id:
Q9BT25
Protein Accession #:
NP_219485
Nucleotide Accession #:
NM_033417
Alias Symbols:
HICE1, MGC20533, NY-SAR-48, DGT4
Replacement Item:
This antibody may replace item sc-240745 from Santa Cruz Biotechnology.
Description of Target:
HAUS8 is 1 of 8 subunits of the 390-kD human augmin complex, or HAUS complex. The augmin complex was first identified in Drosophila, and its name comes from the Latin verb 'augmentare,' meaning 'to increase.' The augmin complex is a microtubule-binding complex involved in microtubule generation within the mitotic spindle and is vital to mitotic spindle assembly (Goshima et al., 2008 [PubMed 18443220]; Uehara et al., 2009 [PubMed 19369198]).
Protein Size (# AA):
410
Molecular Weight:
45kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HAUS8.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HAUS8.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human HAUS8
Predicted Species Reactivity:
Human, Pig
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Pig: 75%
Complete computational species homology data:
Anti-HAUS8 (ARP59892_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QTRGKMSEGGRKSSLLQKSKADSSGVGKGDLQSTLLEGHGTAPPDLDLSA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; APP; HAUS6; HAUS5; Haus4; Haus1; Haus2; Plk1;
Blocking Peptide:
For anti-HAUS8 (ARP59892_P050) antibody is Catalog # AAP59892 (Previous Catalog # AAPP46051)
Datasheets/Manuals:
Printable datasheet for anti-HAUS8 (ARP59892_P050) antibody
Subunit:
8

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...