SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP62671_P050
Price: $0.00
SKU
ARP62671_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-HARS2 (ARP62671_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Guinea Pig, Horse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 79%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Mouse: 79%; Rat: 86%
Peptide SequenceSynthetic peptide located within the following region: LSIGVERIFYIVEQRMKTKGEKVRTTETQVFVATPQKNFLQERLKLIAEL
Concentration0.5 mg/ml
Blocking PeptideFor anti-HARS2 (ARP62671_P050) antibody is Catalog # AAP62671
Sample Type Confirmation

HARS2 is supported by BioGPS gene expression data to be expressed in HeLa

Gene SymbolHARS2
Gene Full NameHistidyl-tRNA synthetase 2, mitochondrial (putative)
Alias SymbolsHO3, HARSL, HARSR, HisRS, PRLTS2
NCBI Gene Id23438
Protein NameProbable histidine--tRNA ligase, mitochondrial
Description of TargetAminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. The protein encoded by this gene is an enzyme belonging to the class II family of aminoacyl-tRNA synthetases. Functioning in the synthesis of histidyl-transfer RNA, the enzyme plays an accessory role in the regulation of protein biosynthesis. The gene is located in a head-to-head orientation with HARS on chromosome five, where the homologous genes share a bidirectional promoter.
Uniprot IDP49590
Protein Accession #NP_036340
Nucleotide Accession #NM_012208
Protein Size (# AA)506
Molecular Weight56kDa
Protein InteractionsAGTRAP; FUS; GRSF1; UBC; gag; BST2; ICT1;
  1. What is the species homology for "HARS2 Antibody - C-terminal region (ARP62671_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Guinea Pig, Horse".

  2. How long will it take to receive "HARS2 Antibody - C-terminal region (ARP62671_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HARS2 Antibody - C-terminal region (ARP62671_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HARS2 Antibody - C-terminal region (ARP62671_P050)"?

    This target may also be called "HO3, HARSL, HARSR, HisRS, PRLTS2" in publications.

  5. What is the shipping cost for "HARS2 Antibody - C-terminal region (ARP62671_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HARS2 Antibody - C-terminal region (ARP62671_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HARS2 Antibody - C-terminal region (ARP62671_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "56kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HARS2 Antibody - C-terminal region (ARP62671_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "HARS2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HARS2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HARS2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HARS2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HARS2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HARS2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HARS2 Antibody - C-terminal region (ARP62671_P050)
Your Rating