Protein on Demand™ HAND1 Recombinant Protein (Human) (OPCA21808)

Datasheets/Manuals	Printable datasheet for OPCA21808

Product Info
Predicted Species Reactivity	Human
Product Format	Liquid
Application	WB, ELISA
Reconstitution and Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Purity	Greater than 85% as determined by SDS-PAGE.
Protein Sequence	MNLVGSYAHHHHHHHPHPAHPMLHEPFLFGPASRCHQERPYFQSWLLSPADAAPDFPAGGPPPAAAAAATAYGPDARPGQSPGRLEALGGRLGRRKGSGPKKERRRTESINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDVLAKDAQSGDPEAFKAELKKADGGRESKRKRELQQHEGFPPALGPVEKRIKGRTGWPQQVWALELNQ
Storage Buffer	Tris-based buffer,50% glycerol
Protein Range	1-215

Gene Full Name	heart and neural crest derivatives expressed 1
Alias Symbols	Hxt, eHand, Thing1, bHLHa27
NCBI Gene Id	9421
Protein Name	heart- and neural crest derivatives-expressed protein 1
Description of Target	The protein encoded by this gene belongs to the basic helix-loop-helix family of transcription factors. This gene product is one of two closely related family members, the HAND proteins, which are asymmetrically expressed in the developing ventricular cha
Uniprot ID	O96004
Protein Accession #	NP_004812.1
Nucleotide Accession #	NM_004821.2
Protein Size (# AA)	215