Search Antibody, Protein, and ELISA Kit Solutions

HAMP Antibody - N-terminal region (ARP41620_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41620_P050-FITC Conjugated

ARP41620_P050-HRP Conjugated

ARP41620_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Hepcidin antimicrobial peptide
NCBI Gene Id:
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-240553 from Santa Cruz Biotechnology.
Description of Target:
The product encoded by this gene is involved in the maintenance of iron homeostasis, and it is necessary for the regulation of iron storage in macrophages, and for intestinal iron absorption. The preproprotein is post-translationally cleaved into mature p
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HAMP.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HAMP.
The immunogen is a synthetic peptide directed towards the N terminal region of human HAMP
Predicted Species Reactivity:
Human, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Rat: 83%
Complete computational species homology data:
Anti-HAMP (ARP41620_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWM
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-HAMP (ARP41620_P050) antibody is Catalog # AAP41620 (Previous Catalog # AAPS09712)
Printable datasheet for anti-HAMP (ARP41620_P050) antibody
Target Reference:
Theurl,I., (2008) Blood 111 (4), 2392-2399

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...