Size:100 ul
$319.00
In stock
SKU
ARP41620_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41620_P050-FITC Conjugated

ARP41620_P050-HRP Conjugated

ARP41620_P050-Biotin Conjugated

HAMP Antibody - N-terminal region (ARP41620_P050)

Catalog#: ARP41620_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-240553 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human HAMP
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Human: 100%; Rat: 83%
Complete computational species homology data Anti-HAMP (ARP41620_P050)
Peptide Sequence Synthetic peptide located within the following region: MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWM
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-HAMP (ARP41620_P050) antibody is Catalog # AAP41620 (Previous Catalog # AAPS09712)
Datasheets/Manuals Printable datasheet for anti-HAMP (ARP41620_P050) antibody
Target Reference Theurl,I., (2008) Blood 111 (4), 2392-2399
Gene Symbol HAMP
Official Gene Full Name Hepcidin antimicrobial peptide
Alias Symbols HEPC, HFE2B, LEAP-1, LEAP1, PLTR
NCBI Gene Id 57817
Protein Name Hepcidin
Description of Target The product encoded by this gene is involved in the maintenance of iron homeostasis, and it is necessary for the regulation of iron storage in macrophages, and for intestinal iron absorption. The preproprotein is post-translationally cleaved into mature p
Swissprot Id P81172
Protein Accession # NP_066998
Nucleotide Accession # NM_021175
Protein Size (# AA) 84
Molecular Weight 9kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express HAMP.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express HAMP.
Protein Interactions CKAP4; VKORC1; SLC40A1;
Write Your Own Review
You're reviewing:HAMP Antibody - N-terminal region (ARP41620_P050)
Your Rating