Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

HADHB Antibody - C-terminal region (ARP48133_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP48133_P050-FITC Conjugated

ARP48133_P050-HRP Conjugated

ARP48133_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), beta subunit
NCBI Gene Id:
Protein Name:
Trifunctional enzyme subunit beta, mitochondrial
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-134922 from Santa Cruz Biotechnology.
Description of Target:
HADHB is the beta subunit of the mitochondrial trifunctional protein, which catalyzes the last three steps of mitochondrial beta-oxidation of long chain fatty acids. The mitochondrial membrane-bound heterocomplex is composed of four alpha and four beta subunits, with the beta subunit catalyzing the 3-ketoacyl-CoA thiolase activity. Mutations in HADHB gene result in trifunctional protein deficiency. The protein can also bind RNA and decreases the stability of some mRNAs.This gene encodes the beta subunit of the mitochondrial trifunctional protein, which catalyzes the last three steps of mitochondrial beta-oxidation of long chain fatty acids. The mitochondrial membrane-bound heterocomplex is composed of four alpha and four beta subunits, with the beta subunit catalyzing the 3-ketoacyl-CoA thiolase activity. Mutations in this gene result in trifunctional protein deficiency. The encoded protein can also bind RNA and decreases the stability of some mRNAs. The genes of the alpha and beta subunits of the mitochondrial trifunctional protein are located adjacent to each other in the human genome in a head-to-head orientation. Alternatively spliced transcript variants have been found; however, their full-length nature is not known. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HADHB.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HADHB.
The immunogen is a synthetic peptide directed towards the C terminal region of human HADHB
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Yeast: 83%; Zebrafish: 86%
Complete computational species homology data:
Anti-HADHB (ARP48133_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LLLGPTYATPKVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-HADHB (ARP48133_P050) antibody is Catalog # AAP48133 (Previous Catalog # AAPP28649)
Printable datasheet for anti-HADHB (ARP48133_P050) antibody
Sample Type Confirmation:

HADHB is supported by BioGPS gene expression data to be expressed in HepG2

beta, mitochondrial
Additional Information:
IHC Information: Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Human Pancreas: Formalin-Fixed, Paraffin-Embedded (FFPE)
Target Reference:
Wang,R., (2006) Zhonghua Fu Chan Ke Za Zhi 41 (10), 672-675

Chen, J; Young, ME; Chatham, JC; Crossman, DK; Dell'Italia, LJ; Shalev, A; TXNIP regulates myocardial fatty acid oxidation via miR-33a signaling. 311, H64-75 (2016). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish 27199118

Gerin, I. et al. Expression of miR-33 from an SREBP2 intron inhibits cholesterol export and fatty acid oxidation. J. Biol. Chem. 285, 33652-61 (2010). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish 20732877

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...