Size:100 ul
$289.00
In stock
SKU
ARP48133_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP48133_P050-FITC Conjugated

ARP48133_P050-HRP Conjugated

ARP48133_P050-Biotin Conjugated

HADHB Antibody - C-terminal region (ARP48133_P050)

Catalog#: ARP48133_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IHC
Additional Information IHC Information: Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Human Pancreas: Formalin-Fixed, Paraffin-Embedded (FFPE)
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-134922 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human HADHB
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Yeast: 83%; Zebrafish: 86%
Complete computational species homology data Anti-HADHB (ARP48133_P050)
Peptide Sequence Synthetic peptide located within the following region: LLLGPTYATPKVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAE
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-HADHB (ARP48133_P050) antibody is Catalog # AAP48133 (Previous Catalog # AAPP28649)
Datasheets/Manuals Printable datasheet for anti-HADHB (ARP48133_P050) antibody
Sample Type Confirmation

HADHB is supported by BioGPS gene expression data to be expressed in HepG2

Subunit beta, mitochondrial
Target Reference Wang,R., (2006) Zhonghua Fu Chan Ke Za Zhi 41 (10), 672-675
Publications

Chen, J; Young, ME; Chatham, JC; Crossman, DK; Dell'Italia, LJ; Shalev, A; TXNIP regulates myocardial fatty acid oxidation via miR-33a signaling. 311, H64-75 (2016). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish 27199118

Gerin, I. et al. Expression of miR-33 from an SREBP2 intron inhibits cholesterol export and fatty acid oxidation. J. Biol. Chem. 285, 33652-61 (2010). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish 20732877

Gene Symbol HADHB
Official Gene Full Name Hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), beta subunit
Alias Symbols MGC87480, MSTP029, TP-BETA, ECHB, MTPB
NCBI Gene Id 3032
Protein Name Trifunctional enzyme subunit beta, mitochondrial
Description of Target HADHB is the beta subunit of the mitochondrial trifunctional protein, which catalyzes the last three steps of mitochondrial beta-oxidation of long chain fatty acids. The mitochondrial membrane-bound heterocomplex is composed of four alpha and four beta subunits, with the beta subunit catalyzing the 3-ketoacyl-CoA thiolase activity. Mutations in HADHB gene result in trifunctional protein deficiency. The protein can also bind RNA and decreases the stability of some mRNAs.This gene encodes the beta subunit of the mitochondrial trifunctional protein, which catalyzes the last three steps of mitochondrial beta-oxidation of long chain fatty acids. The mitochondrial membrane-bound heterocomplex is composed of four alpha and four beta subunits, with the beta subunit catalyzing the 3-ketoacyl-CoA thiolase activity. Mutations in this gene result in trifunctional protein deficiency. The encoded protein can also bind RNA and decreases the stability of some mRNAs. The genes of the alpha and beta subunits of the mitochondrial trifunctional protein are located adjacent to each other in the human genome in a head-to-head orientation. Alternatively spliced transcript variants have been found; however, their full-length nature is not known. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id P55084
Protein Accession # NP_000174
Nucleotide Accession # NM_000183
Protein Size (# AA) 474
Molecular Weight 47kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express HADHB.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express HADHB.
Protein Interactions HUWE1; TP53; TUBG1; SUMO2; SUMO3; UBC; PARK2; PPP6R1; ADRB2; CSNK2A2; PAN2; ATF2; vpu; TIMM8B; COX17; IQCB1; SUOX; CHCHD4; TUBB1; RPS8; OPA1; HSP90AB1; HADHA; DES; GRK5; FBXO6; CDK2; LEO1; RTF1; TK1; SMN1; PSMA3; GRB7; RCC1; CDKN1A; ANXA7; Edc4; MYC; SQST
Write Your Own Review
You're reviewing:HADHB Antibody - C-terminal region (ARP48133_P050)
Your Rating