- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-HADHA (OAAN01214) |
---|
Predicted Species Reactivity | Human, Mouse |
---|---|
Product Format | Liquid. PBS with 0.02% sodium azide, 50% glycerol, pH 7.3 |
Clonality | Polyclonal |
Isotype | IgG |
Host | Rabbit |
Application | WB, IF |
Additional Information | Positive samples: K-562, THP-1, SW480, PC-3, HeLa, Mouse intestine, Mouse heart, Mouse adipose Cellular location: Mitochondrion |
Reconstitution and Storage | Store at -20C. Avoid repeated freeze/thaw cycles. |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 484-763 of human HADHA (NP_000173.2). |
Purification | Affinity purification |
Peptide Sequence | IAAVSKRPEKVIGMHYFSPVDKMQLLEIITTEKTSKDTSASAVAVGLKQGKVIIVVKDGPGFYTTRCLAPMMSEVIRILQEGVDPKKLDSLTTSFGFPVGAATLVDEVGVDVAKHVAEDLGKVFGERFGGGNPELLTQMVSKGFLGRKSGKGFYIYQEGVKRKDLNSDMDSILASLKLPPKSEVSSDEDIQFRLVTRFVNEAVMCLQEGILATPAEGDIGAVFGLGFPPCLGGPFRFVDLYGAQKIVDRLKKYEAAYGKQFTPCQLLADHANSPNKKFYQ |
Application Info | WB: 1:500 - 1:2,000 IF: 1:50 - 1:200 |
Gene Symbol | HADHA |
---|---|
Gene Full Name | hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit |
Alias Symbols | GBP, ECHA, HADH, LCEH, MTPA, LCHAD, TP-ALPHA |
NCBI Gene Id | 3030 |
Protein Name | Trifunctional enzyme subunit alpha, mitochondrial |
Description of Target | This gene encodes the alpha subunit of the mitochondrial trifunctional protein, which catalyzes the last three steps of mitochondrial beta-oxidation of long chain fatty acids. The mitochondrial membrane-bound heterocomplex is composed of four alpha and four beta subunits, with the alpha subunit catalyzing the 3-hydroxyacyl-CoA dehydrogenase and enoyl-CoA hydratase activities. Mutations in this gene result in trifunctional protein deficiency or LCHAD deficiency. The genes of the alpha and beta subunits of the mitochondrial trifunctional protein are located adjacent to each other in the human genome in a head-to-head orientation. |
Uniprot ID | P40939 |
Protein Accession # | NP_000173.2 |
Nucleotide Accession # | NM_000182.4 |
Molecular Weight | 82 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "HADHA Antibody (OAAN01214)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse".
-
How long will it take to receive "HADHA Antibody (OAAN01214)"?
This item is available "Domestic: within 1-2 weeks delivery | International: 1-2 weeks".
-
What buffer format is "HADHA Antibody (OAAN01214)" provided in?
This item is provided in "Liquid. PBS with 0.02% sodium azide, 50% glycerol, pH 7.3 ".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "HADHA Antibody (OAAN01214)"?
This target may also be called "GBP, ECHA, HADH, LCEH, MTPA, LCHAD, TP-ALPHA" in publications.
-
What is the shipping cost for "HADHA Antibody (OAAN01214)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "HADHA Antibody (OAAN01214)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "HADHA Antibody (OAAN01214)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "82 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "HADHA Antibody (OAAN01214)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "HADHA"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "HADHA"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "HADHA"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "HADHA"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "HADHA"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "HADHA"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.