HABP2 Antibody - middle region (ARP54718_P050)

Catalog No: ARP54718_P050

WB Suggested Anti-HABP2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HABP2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: EPSTKLPGFDSCGKTEIAERKIKRIYGGFKSTAGKHPWQASLQSSLPLTI
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-HABP2 (ARP54718_P050) antibody is Catalog # AAP54718 (Previous Catalog # AAPP31513)
• Reference: Sidelmann,J.J., (er) Thromb. Res. (2008) In press

Target Info

• Gene Symbol: HABP2
• Gene Full Name: Hyaluronan binding protein 2
• Alias Symbols: FSAP, HABP, PHBP, HGFAL, NMTC5
• NCBI Gene Id: 3026
• Protein Name: Hyaluronan-binding protein 2
• Description of Target: HABP2 is an extracellular serine protease that binds hyaluronic acid and is involved in cell adhesion. It is synthesized as a single chain, but then undergoes an autoproteolytic event to form the functional heterodimer. Further autoproteolysis leads to smaller, inactive peptides. This protease is known to cleave urinary plasminogen activator, coagulation factor VII, and the alpha and beta chains of fibrinogen, but not prothrombin, plasminogen, or the gamma chain of fibrinogen. The protein encoded by this gene is an extracellular serine protease that binds hyaluronic acid and is involved in cell adhesion. The encoded protein is synthesized as a single chain, but then undergoes an autoproteolytic event to form the functional heterodimer. Further autoproteolysis leads to smaller, inactive peptides. This protease is known to cleave urinary plasminogen activator, coagulation factor VII, and the alpha and beta chains of fibrinogen, but not prothrombin, plasminogen, or the gamma chain of fibrinogen. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: Q14520
• Protein Accession #: NP_004123
• Nucleotide Accession #: NM_004132
• Protein Size (# AA): 560
• Molecular Weight: 63kDa
• Protein Interactions: COL4A6; COL4A5; KNG1; COL4A4; COL4A1; COL4A2; COL4A3;