Search Antibody, Protein, and ELISA Kit Solutions

H6PD Antibody - N-terminal region (ARP51206_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP51206_P050-FITC Conjugated

ARP51206_P050-HRP Conjugated

ARP51206_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase)
NCBI Gene Id:
Protein Name:
GDH/6PGL endoplasmic bifunctional protein
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
DKFZp686A01246, G6PDH, GDH, MGC87643
Replacement Item:
This antibody may replace item sc-377180, HPA004824
Description of Target:
There are 2 forms of glucose-6-phosphate dehydrogenase. G form is X-linked and H form is autosomally linked. This H form shows activity with other hexose-6-phosphates, especially galactose-6-phosphate, whereas the G form is specific for glucose-6-phosphate. Both forms are present in most tissues, but H form is not found in red cells.There are 2 forms of glucose-6-phosphate dehydrogenase. G form is X-linked and H form, encoded by this gene, is autosomally linked. This H form shows activity with other hexose-6-phosphates, especially galactose-6-phosphate, whereas the G form is specific for glucose-6-phosphate. Both forms are present in most tissues, but H form is not found in red cells. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express H6PD.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express H6PD.
The immunogen is a synthetic peptide directed towards the N terminal region of human H6PD
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%
Complete computational species homology data:
Anti-H6PD (ARP51206_P050)
Peptide Sequence:
Synthetic peptide located within the following region: HFSAQQLATELGTFFQEEEMYRVDHYLGKQAVAQILPFRDQNRKALDGLW
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-H6PD (ARP51206_P050) antibody is Catalog # AAP51206 (Previous Catalog # AAPP28074)
Printable datasheet for anti-H6PD (ARP51206_P050) antibody
Sample Type Confirmation:

H6PD is supported by BioGPS gene expression data to be expressed in 721_B

Target Reference:
Smit,P., (2007) J. Clin. Endocrinol. Metab. 92 (1), 359-362

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...