Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP51206_P050-FITC Conjugated

ARP51206_P050-HRP Conjugated

ARP51206_P050-Biotin Conjugated

H6PD Antibody - N-terminal region (ARP51206_P050)

Catalog#: ARP51206_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-377180, HPA004824
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human H6PD
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%
Complete computational species homology data Anti-H6PD (ARP51206_P050)
Peptide Sequence Synthetic peptide located within the following region: HFSAQQLATELGTFFQEEEMYRVDHYLGKQAVAQILPFRDQNRKALDGLW
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-H6PD (ARP51206_P050) antibody is Catalog # AAP51206 (Previous Catalog # AAPP28074)
Datasheets/Manuals Printable datasheet for anti-H6PD (ARP51206_P050) antibody
Sample Type Confirmation

H6PD is supported by BioGPS gene expression data to be expressed in 721_B

Target Reference Smit,P., (2007) J. Clin. Endocrinol. Metab. 92 (1), 359-362
Gene Symbol H6PD
Official Gene Full Name Hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase)
Alias Symbols DKFZp686A01246, G6PDH, GDH, MGC87643
NCBI Gene Id 9563
Protein Name GDH/6PGL endoplasmic bifunctional protein
Description of Target There are 2 forms of glucose-6-phosphate dehydrogenase. G form is X-linked and H form is autosomally linked. This H form shows activity with other hexose-6-phosphates, especially galactose-6-phosphate, whereas the G form is specific for glucose-6-phosphate. Both forms are present in most tissues, but H form is not found in red cells.There are 2 forms of glucose-6-phosphate dehydrogenase. G form is X-linked and H form, encoded by this gene, is autosomally linked. This H form shows activity with other hexose-6-phosphates, especially galactose-6-phosphate, whereas the G form is specific for glucose-6-phosphate. Both forms are present in most tissues, but H form is not found in red cells. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id O95479
Protein Accession # NP_004276
Nucleotide Accession # NM_004285
Protein Size (# AA) 791
Molecular Weight 89kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express H6PD.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express H6PD.
Protein Interactions SUMO1; NEDD8; FBXO6;
  1. What is the species homology for "H6PD Antibody - N-terminal region (ARP51206_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "H6PD Antibody - N-terminal region (ARP51206_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "H6PD Antibody - N-terminal region (ARP51206_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "H6PD Antibody - N-terminal region (ARP51206_P050)"?

    This target may also be called "DKFZp686A01246, G6PDH, GDH, MGC87643" in publications.

  5. What is the shipping cost for "H6PD Antibody - N-terminal region (ARP51206_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "H6PD Antibody - N-terminal region (ARP51206_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "H6PD Antibody - N-terminal region (ARP51206_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "89kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "H6PD Antibody - N-terminal region (ARP51206_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "H6PD"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "H6PD"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "H6PD"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "H6PD"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "H6PD"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "H6PD"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:H6PD Antibody - N-terminal region (ARP51206_P050)
Your Rating
We found other products you might like!