Loading...
Catalog No: ARP58283_P050
Price: $0.00
SKU
ARP58283_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-H2AFY (ARP58283_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human H2AFY
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: PVSKKAGGKKGARKSKKQGEVSKAASADSTTEGTPADGFTVLSTKSLFLG
Concentration0.5 mg/ml
Blocking PeptideFor anti-H2AFY (ARP58283_P050) antibody is Catalog # AAP58283 (Previous Catalog # AAPP32882)
Sample Type Confirmation

H2AFY is strongly supported by BioGPS gene expression data to be expressed in HEK293T

ReferenceBernstein,E., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (5), 1533-1538
Gene SymbolH2AFY
Gene Full NameH2A histone family, member Y
Alias SymbolsH2A.y, H2A/y, H2AFY, mH2A1, H2AF12M, MACROH2A1.1, macroH2A1.2
NCBI Gene Id9555
Protein NameCore histone macro-H2A.1
Description of TargetHistones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. H2AFY is a member of the histone H2A family. It replaces conventional H2A histones in a subset of nucleosomes where it represses transcription and participates in stable X chromosome inactivation. Alternative splicing results in multiple transcript variants encoding different isoforms.Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a member of the histone H2A family. It replaces conventional H2A histones in a subset of nucleosomes where it represses transcription and participates in stable X chromosome inactivation. Alternative splicing results in multiple transcript variants encoding different isoforms.
Uniprot IDO75367
Protein Accession #NP_001035248
Nucleotide Accession #NM_001040158
Protein Size (# AA)371
Molecular Weight39kDa
Protein InteractionsERICH2; UBC; SUMO2; SUMO3; HIST1H3A; H3F3A; SUZ12; EED; RNF2; EZH2; BMI1; SRPK1; LMNA; ATF2; FN1; HIST1H3B; CENPA; APP; CBX5; CBX3; DIDO1; UBD; ATXN1L; NEDD8; ERBB2; SUMO1; HDGF; HDAC2; HDAC1; PARP1; tat; CUL3; SPOP; WDR77; PHF14; DEK; XRCC5; TOP1; RAN; H
  1. What is the species homology for "H2AFY Antibody - middle region (ARP58283_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit".

  2. How long will it take to receive "H2AFY Antibody - middle region (ARP58283_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "H2AFY Antibody - middle region (ARP58283_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "H2AFY Antibody - middle region (ARP58283_P050)"?

    This target may also be called "H2A.y, H2A/y, H2AFY, mH2A1, H2AF12M, MACROH2A1.1, macroH2A1.2" in publications.

  5. What is the shipping cost for "H2AFY Antibody - middle region (ARP58283_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "H2AFY Antibody - middle region (ARP58283_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "H2AFY Antibody - middle region (ARP58283_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "39kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "H2AFY Antibody - middle region (ARP58283_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "H2AFY"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "H2AFY"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "H2AFY"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "H2AFY"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "H2AFY"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "H2AFY"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:H2AFY Antibody - middle region (ARP58283_P050)
Your Rating
We found other products you might like!