Catalog No: ARP58280_P050-Biotin
Size:100ul
Price: $434.00
SKU
ARP58280_P050-Biotin
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-H2AFX (ARP58280_P050-Biotin) antibody
Product Info
ReferenceScherthan,H., (2008) Biochem. Biophys. Res. Commun. 371 (4), 694-697
Publications

Wen, W. et al. MST1 promotes apoptosis through phosphorylation of histone H2AX. J. Biol. Chem. 285, 39108-16 (2010). WB, Zebrafish, Rat, Dog, Guinea pig, Human, Mouse, Bovine, Horse 20921231

Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human H2AFX
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: SGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVY
Concentration0.5 mg/ml
Blocking PeptideFor anti-H2AFX (ARP58280_P050-Biotin) antibody is Catalog # AAP58280 (Previous Catalog # AAPP32879)
Sample Type Confirmation

There is BioGPS gene expression data showing that H2AFX is expressed in HepG2

Gene SymbolH2AFX
Gene Full NameH2A histone family, member X
Alias SymbolsH2A.X, H2A/X, H2AFX
NCBI Gene Id3014
Protein NameHistone H2A.x
Description of TargetHistones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. H2AFX is a member of the histone H2A family, and generates two transcripts through the use of the conserved stem-loop termination motif, and the polyA addition motif.Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene encodes a member of the histone H2A family, and generates two transcripts through the use of the conserved stem-loop termination motif, and the polyA addition motif. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP16104
Protein Accession #NP_002096
Nucleotide Accession #NM_002105
Protein Size (# AA)143
Molecular Weight16kDa
Protein InteractionsUBC; HIST1H3A; USP17L2; UBD; RNF8; DDX21; XRCC6; NBN; NCL; HIST1H3B; ESR1; CENPA; TP53BP1; TOPORS; MDC1; BRCA1; ATR; ATM; PRKDC; CBX5; TRIM28; EGFR; BMI1; HIST2H3C; PML; XRCC5; UBB; TERF2; RNF2; SIRT7; CSNK2A1; ARRB2; ARRB1; PAXIP1; MRE11A; ATF2; MCPH1; C
  1. What is the species homology for "H2AFX Antibody - N-terminal region : Biotin (ARP58280_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish".

  2. How long will it take to receive "H2AFX Antibody - N-terminal region : Biotin (ARP58280_P050-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "H2AFX Antibody - N-terminal region : Biotin (ARP58280_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "H2AFX Antibody - N-terminal region : Biotin (ARP58280_P050-Biotin)"?

    This target may also be called "H2A.X, H2A/X, H2AFX" in publications.

  5. What is the shipping cost for "H2AFX Antibody - N-terminal region : Biotin (ARP58280_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "H2AFX Antibody - N-terminal region : Biotin (ARP58280_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "H2AFX Antibody - N-terminal region : Biotin (ARP58280_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "16kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "H2AFX Antibody - N-terminal region : Biotin (ARP58280_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "H2AFX"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "H2AFX"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "H2AFX"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "H2AFX"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "H2AFX"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "H2AFX"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:H2AFX Antibody - N-terminal region : Biotin (ARP58280_P050-Biotin)
Your Rating
We found other products you might like!