Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP58280_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP58280_P050-FITC Conjugated

ARP58280_P050-HRP Conjugated

ARP58280_P050-Biotin Conjugated

H2AFX Antibody - N-terminal region (ARP58280_P050)

Catalog#: ARP58280_P050
Domestic: within 1-2 days delivery International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human H2AFX
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data Anti-H2AFX (ARP58280_P050)
Peptide Sequence Synthetic peptide located within the following region: SGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVY
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-H2AFX (ARP58280_P050) antibody is Catalog # AAP58280 (Previous Catalog # AAPP32879)
Datasheets/Manuals Printable datasheet for anti-H2AFX (ARP58280_P050) antibody
Sample Type Confirmation

There is BioGPS gene expression data showing that H2AFX is expressed in HepG2

Target Reference Scherthan,H., (2008) Biochem. Biophys. Res. Commun. 371 (4), 694-697
Publications

Wen, W. et al. MST1 promotes apoptosis through phosphorylation of histone H2AX. J. Biol. Chem. 285, 39108-16 (2010). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish 20921231

Gene Symbol H2AFX
Official Gene Full Name H2A histone family, member X
Alias Symbols H2A.X, H2A/X, H2AX
NCBI Gene Id 3014
Protein Name Histone H2A.x
Description of Target Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. H2AFX is a member of the histone H2A family, and generates two transcripts through the use of the conserved stem-loop termination motif, and the polyA addition motif.Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene encodes a member of the histone H2A family, and generates two transcripts through the use of the conserved stem-loop termination motif, and the polyA addition motif. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id P16104
Protein Accession # NP_002096
Nucleotide Accession # NM_002105
Protein Size (# AA) 143
Molecular Weight 16kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express H2AFX.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express H2AFX.
Protein Interactions UBC; HIST1H3A; USP17L2; UBD; RNF8; DDX21; XRCC6; NBN; NCL; HIST1H3B; ESR1; CENPA; TP53BP1; TOPORS; MDC1; BRCA1; ATR; ATM; PRKDC; CBX5; TRIM28; EGFR; BMI1; HIST2H3C; PML; XRCC5; UBB; TERF2; RNF2; SIRT7; CSNK2A1; ARRB2; ARRB1; PAXIP1; MRE11A; ATF2; MCPH1; C
Write Your Own Review
You're reviewing:H2AFX Antibody - N-terminal region (ARP58280_P050)
Your Rating