Search Antibody, Protein, and ELISA Kit Solutions

H2AFX Antibody - N-terminal region (ARP58280_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP58280_P050-FITC Conjugated

ARP58280_P050-HRP Conjugated

ARP58280_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
Official Gene Full Name:
H2A histone family, member X
NCBI Gene Id:
Protein Name:
Histone H2A.x
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
H2A.X, H2A/X, H2AX
Description of Target:
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. H2AFX is a member of the histone H2A family, and generates two transcripts through the use of the conserved stem-loop termination motif, and the polyA addition motif.Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene encodes a member of the histone H2A family, and generates two transcripts through the use of the conserved stem-loop termination motif, and the polyA addition motif. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express H2AFX.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express H2AFX.
The immunogen is a synthetic peptide directed towards the N terminal region of human H2AFX
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-H2AFX (ARP58280_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVY
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-H2AFX (ARP58280_P050) antibody is Catalog # AAP58280 (Previous Catalog # AAPP32879)
Printable datasheet for anti-H2AFX (ARP58280_P050) antibody
Sample Type Confirmation:

There is BioGPS gene expression data showing that H2AFX is expressed in HepG2

Target Reference:
Scherthan,H., (2008) Biochem. Biophys. Res. Commun. 371 (4), 694-697

Wen, W. et al. MST1 promotes apoptosis through phosphorylation of histone H2AX. J. Biol. Chem. 285, 39108-16 (2010). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish 20921231

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...