Search Antibody, Protein, and ELISA Kit Solutions

H1F0-A Recombinant Protein (African clawed frog) (OPCA04276)

* Required Fields

$0.00
In Stock
Request Bulk Order Quote

Predicted Species Reactivity:
African clawed frog
Product Format:
Liquid
Additional Information:
Species Specificity Detail: Xenopus laevis (African clawed frog)
Reconstitution and Storage:
Store at -20/-80C for 12 months. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Gene Symbol:
H1F0-A
Official Gene Full Name:
H1 histone family member 0 L homeolog
Alias Symbols:
h1(0)-1, h10, h1f0, h1fv
NCBI Gene Id:
398662
Protein Name:
Histone H1.0-A
Description of Target:
Histones H1 are necessary for the condensation of nucleosome chains into higher-order structures. The H1F0 histones are found in cells that are in terminal stages of differentiation or that have low rates of cell division
Swissprot Id:
P22845
Protein Accession #:
NP_001082697
Nucleotide Accession #:
NM_001089228
Molecular Weight:
37 kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express H1F0-A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express H1F0-A.
Formulation:
Tris-base, 50% glycerol
Purity:
Greater than 90% as determined by SDS-PAGE.
Protein Sequence:
Full Length: MTENSAPAAKPRRSKASKKSTDHPKYSDMILDAVQAEKSRSGSSRQSIQKYIKNNYTVGENADSQIKLSIKRLVTSGTLKQTKGVGASGSFRLAKADEVKKPAKKPKKEIKKAVSPKKAAKPKKAAKSPAKAKKPKVAEKKVKKAPKKKPAPSPRKAKKTKTVRAKPVWASKAKKAKPSKPKAKASPKKSGRKK
Storage Buffer:
Tris-base, 50% glycerol
Source:
E.coli
Tag:
N-terminal 6xHis-SUMO-tagged
Target Reference:
Characterization of the two H1(0)-encoding genes from Xenopus laevis.Brocard M., Triebe S., Peretti M., Doenecke D., Khochbin S.Gene 189:127-134(1997)
Datasheets/Manuals:
Printable datasheet for OPCA04276

Product Reviews

Protocol:
Tips Information:

Tell us what you think about this item!

Write A Review
    Please, wait...