H1F0-A Recombinant Protein (African clawed frog) (OPCA04276)

Catalog No: OPCA04276

Product Info

• Predicted Species Reactivity: Xenopus laevis
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Xenopus laevis (African clawed frog)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: MTENSAPAAKPRRSKASKKSTDHPKYSDMILDAVQAEKSRSGSSRQSIQKYIKNNYTVGENADSQIKLSIKRLVTSGTLKQTKGVGASGSFRLAKADEVKKPAKKPKKEIKKAVSPKKAAKPKKAAKSPAKAKKPKVAEKKVKKAPKKKPAPSPRKAKKTKTVRAKPVWASKAKKAKPSKPKAKASPKKSGRKK
• Protein Sequence: MTENSAPAAKPRRSKASKKSTDHPKYSDMILDAVQAEKSRSGSSRQSIQKYIKNNYTVGENADSQIKLSIKRLVTSGTLKQTKGVGASGSFRLAKADEVKKPAKKPKKEIKKAVSPKKAAKPKKAAKSPAKAKKPKVAEKKVKKAPKKKPAPSPRKAKKTKTVRAKPVWASKAKKAKPSKPKAKASPKKSGRKK
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 1-194 aa
• Tag: N-terminal 6xHis-SUMO-tagged
• Reference: Characterization of the two H1(0)-encoding genes from Xenopus laevis.Brocard M., Triebe S., Peretti M., Doenecke D., Khochbin S.Gene 189:127-134(1997)

Target Info

• Gene Symbol: h1-0.L
• Gene Full Name: H1.0 linker histone L homeolog
• Alias Symbols: H1 histone family member 0 L homeolog;H1 histone family, member 0;h1(0)-1;h10;h1-0-a;H1E;h1f0;h1f0.L;h1f0-a;h1f0-b;h1fv;H1-SB;H1zero;histone H1(0)-1;histone H1.0-A;histone H5B;XELAEV_18023705mg;xlH5B.
• NCBI Gene Id: 398662
• Protein Name: Histone H1.0-A
• Description of Target: Histones H1 are necessary for the condensation of nucleosome chains into higher-order structures. The H1F0 histones are found in cells that are in terminal stages of differentiation or that have low rates of cell division (By similarity).
• Uniprot ID: P22845
• Protein Accession #: NP_001082697
• Nucleotide Accession #: NM_001089228
• Protein Size (# AA): Recombinant
• Molecular Weight: 37 kDa