GUCA1A Antibody - N-terminal region : Biotin (ARP54309_P050-Biotin)

Catalog No: ARP54309_P050-Biotin

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: Biotin
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GUCA1A
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: LYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GUCA1A (ARP54309_P050-Biotin) antibody is Catalog # AAP54309 (Previous Catalog # AAPP31058)

Target Info

• Reference: Michaelides,M., (2005) Ophthalmology 112 (8), 1442-1447
• Gene Symbol: GUCA1A
• Gene Full Name: Guanylate cyclase activator 1A (retina)
• Alias Symbols: COD3, GCAP, GUCA, GCAP1, GUCA1, CORD14, C6orf131
• NCBI Gene Id: 2978
• Protein Name: Guanylyl cyclase-activating protein 1
• Description of Target: GUCA1A(GCAP1) plays a role in the recovery of retinal photoreceptors from photobleaching. In the recovery phase, the phototransduction messeneger cGMP is replenished by retinal guanylyl cyclase-1 (GC1). GC1 is activated by decreasing Ca(2+) concentrations following photobleaching. The protein mediates the sensitivity of GC1 to Ca(2+) concentrations. GCAP1 promotes activity of GC1 at low Ca(2+) concentrations and inhibits GC1 activity at high Ca(2+) concentrations. Mutations in this gene cause autosomal dominant cone dystrophy (COD3); a disease characterized by reduced visual acuity associated with progressive loss of color vision. Mutations in this gene prohibit the inactivation of RetGC1 at high Ca(2+) concentrations; causing the constitutive activation of RetGC1 and, presumably, increased cell death. This gene is expressed in retina and spermatagonia.
• Uniprot ID: P43080
• Protein Accession #: NP_000400
• Nucleotide Accession #: NM_000409
• Protein Size (# AA): 201
• Molecular Weight: 23kDa
• Protein Interactions: GUCY2D;