GUAMERIN Recombinant Protein (Korean blood-sucking leech) (OPCA04632)

Catalog No: OPCA04632

Product Info

• Predicted Species Reactivity: Hirudo nipponia
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Hirudo nipponia (Korean blood-sucking leech)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: VDENAEDTHGLCGEKTCSPAQVCLNNECACTAIRCMIFCPNGFKVDENGCEYPCTCA
• Protein Sequence: VDENAEDTHGLCGEKTCSPAQVCLNNECACTAIRCMIFCPNGFKVDENGCEYPCTCA
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yeast
• Protein Range: 1-57 aa
• Tag: N-terminal 6xHis-tagged

Target Info

• Reference: Isolation and characterization of guamerin, a new human leukocyte elastase inhibitor from Hirudo nipponia.Jung H.I., Kim S.I., Ha K.-S., Joe C.O., Kang K.W.J. Biol. Chem. 270:13879-13884(1995)
• Alias Symbols: Guamerin
• Protein Name: Guamerin
• Description of Target: Inhibits mammalian elastases.
• Uniprot ID: P46443
• Protein Size (# AA): Recombinant
• Molecular Weight: 8.1 kDa