Catalog No: P100893_P050
Price: $0.00
SKU
P100893_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-GTF2H2 (P100893_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Horse, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human GTF2H2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 92%
Peptide SequenceSynthetic peptide located within the following region: DILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTL
Concentration0.5 mg/ml
Blocking PeptideFor anti-GTF2H2 (P100893_P050) antibody is Catalog # AAP31241 (Previous Catalog # AAPP01986)
Sample Type Confirmation

GTF2H2 is supported by BioGPS gene expression data to be expressed in Jurkat

Subunit2
ReferenceRen,P., (2007) Am. J. Respir. Crit. Care Med. 175 (11), 1151-1157
Gene SymbolGTF2H2
Gene Full NameGeneral transcription factor IIH, polypeptide 2, 44kDa
Alias Symbolsp44, BTF2, TFIIH, BTF2P44, T-BTF2P44
NCBI Gene Id2966
Protein NameGeneral transcription factor IIH subunit 2
Description of TargetGTF2H2 gene is part of a 500 kb inverted duplication on chromosome 5q13. This duplicated region contains at least four genes and repetitive elements which make it prone to rearrangements and deletions. The repetitiveness and complexity of the sequence have also caused difficulty in determining the organization of this genomic region. This gene is within the telomeric copy of the duplication. Deletion of this gene sometimes accompanies deletion of the neighboring SMN1 gene in spinal muscular atrophy (SMA) patients but it is unclear if deletion of this gene contributes to the SMA phenotype. GTF2H2 is the 44 kDa subunit of RNA polymerase II transcription initiation factor IIH which is involved in basal transcription and nucleotide excision repair. Transcript variants for this gene have been described, but their full length nature has not been determined. A second copy of this gene within the centromeric copy of the duplication has been described in the literature. It is reported to be different by either two or four base pairs; however, no sequence data is currently available for the centromeric copy of the gene.This gene is part of a 500 kb inverted duplication on chromosome 5q13. This duplicated region contains at least four genes and repetitive elements which make it prone to rearrangements and deletions. The repetitiveness and complexity of the sequence have also caused difficulty in determining the organization of this genomic region. This gene is within the telomeric copy of the duplication. Deletion of this gene sometimes accompanies deletion of the neighboring SMN1 gene in spinal muscular atrophy (SMA) patients but it is unclear if deletion of this gene contributes to the SMA phenotype. This gene encodes the 44 kDa subunit of RNA polymerase II transcription initiation factor IIH which is involved in basal transcription and nucleotide excision repair. Transcript variants for this gene have been described, but their full length nature has not been determined. A second copy of this gene within the centromeric copy of the duplication has been described in the literature. It is reported to be different by either two or four base pairs; however, no sequence data is currently available for the centromeric copy of the gene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-15 BM083743.1 1-15 16-1121 AF078847.1 1-1106 1122-1537 BG283896.1 128-543 1538-1951 AC044797.5 132110-132523 c
Uniprot IDQ13888
Protein Accession #NP_001506
Nucleotide Accession #NM_001515
Protein Size (# AA)395
Molecular Weight44kDa
Protein InteractionsUBC; CDK7; GTF2H5; GTF2H1; SRA1; GTF2H4; GTF2H3; UBD; COPS2; ERCC3; ERCC8; ERCC2; AR; MNAT1; CCNH;
  1. What is the species homology for "GTF2H2 Antibody - N-terminal region (P100893_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Horse, Zebrafish".

  2. How long will it take to receive "GTF2H2 Antibody - N-terminal region (P100893_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GTF2H2 Antibody - N-terminal region (P100893_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GTF2H2 Antibody - N-terminal region (P100893_P050)"?

    This target may also be called "p44, BTF2, TFIIH, BTF2P44, T-BTF2P44" in publications.

  5. What is the shipping cost for "GTF2H2 Antibody - N-terminal region (P100893_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GTF2H2 Antibody - N-terminal region (P100893_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GTF2H2 Antibody - N-terminal region (P100893_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "44kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GTF2H2 Antibody - N-terminal region (P100893_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "GTF2H2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GTF2H2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GTF2H2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GTF2H2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GTF2H2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GTF2H2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GTF2H2 Antibody - N-terminal region (P100893_P050)
Your Rating