Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

GTF2A1L Antibody - C-terminal region (ARP53837_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP53837_P050-FITC Conjugated

ARP53837_P050-HRP Conjugated

ARP53837_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
General transcription factor IIA, 1-like
NCBI Gene Id:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
ALF, MGC26254
Replacement Item:
This antibody may replace item sc-130304 from Santa Cruz Biotechnology.
Description of Target:
The assembly and stability of the RNA polymerase II transcription pre-initiation complex on a eukaryotic core promoter involve the effects of TFIIA on the interaction between TATA-binding protein (TBP) and DNA. This gene encodes a germ cell-specific counterpart of the large (alpha/beta) subunit of general transcription factor TFIIA that is able to stabilize the binding of TBP to DNA and may be uniquely important to testis biology.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GTF2A1L.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GTF2A1L.
The immunogen is a synthetic peptide directed towards the C terminal region of human GTF2A1L
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 79%; Dog: 86%; Horse: 86%; Human: 100%; Mouse: 79%; Rat: 86%
Complete computational species homology data:
Anti-GTF2A1L (ARP53837_P050)
Peptide Sequence:
Synthetic peptide located within the following region: EFLGNIDGGDLKVPEEEADSISNEDSATNSSDNEDPQVNIVEEDPLNSGD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-GTF2A1L (ARP53837_P050) antibody is Catalog # AAP53837 (Previous Catalog # AAPP45612)
Printable datasheet for anti-GTF2A1L (ARP53837_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...