Loading...
Catalog No: ARP58154_P050
Price: $0.00
SKU
ARP58154_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-GTF2A1 (ARP58154_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human GTF2A1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: ANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLM
Concentration0.5 mg/ml
Blocking PeptideFor anti-GTF2A1 (ARP58154_P050) antibody is Catalog # AAP58154 (Previous Catalog # AAPP32587)
Subunit1
ReferenceHieb,A.R., (2007) J. Mol. Biol. 372 (3), 619-632
Gene SymbolGTF2A1
Gene Full NameGeneral transcription factor IIA, 1, 19/37kDa
Alias SymbolsTF2A1, TFIIA, TFIIAL, TFIIA-42
NCBI Gene Id2957
Protein NameTranscription initiation factor IIA subunit 1
Description of TargetGTF2A1 belongs to the TFIIA subunit 1 family. It is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. This protein induces a conformational change within the TBP/TATA complex that enhances its stability under both in vitro and physiological salt conditions.
Uniprot IDP52655
Protein Accession #NP_056943
Nucleotide Accession #NM_015859
Protein Size (# AA)376
Molecular Weight41kDa
Protein InteractionsHUWE1; NFYA; GTF2A2; UBC; FAM129B; SNX6; RPUSD2; GORASP2; BOP1; ATG7; PDIA6; UGDH; TBCD; SARS; RDX; ME1; GARS; BLMH; ATP6V1C1; LMNA; TAF4B; SIRT1; ZEB1; SUMO3; SUMO1; TBP; TERF2; MKX; KDM5B; CREB1; TBPL2; DOCK7; MYLK2; CNOT1; GCN1L1; TBPL1; TAF6; TAF5; TA
  1. What is the species homology for "GTF2A1 Antibody - N-terminal region (ARP58154_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "GTF2A1 Antibody - N-terminal region (ARP58154_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GTF2A1 Antibody - N-terminal region (ARP58154_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GTF2A1 Antibody - N-terminal region (ARP58154_P050)"?

    This target may also be called "TF2A1, TFIIA, TFIIAL, TFIIA-42" in publications.

  5. What is the shipping cost for "GTF2A1 Antibody - N-terminal region (ARP58154_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GTF2A1 Antibody - N-terminal region (ARP58154_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GTF2A1 Antibody - N-terminal region (ARP58154_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "41kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GTF2A1 Antibody - N-terminal region (ARP58154_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "GTF2A1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GTF2A1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GTF2A1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GTF2A1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GTF2A1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GTF2A1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GTF2A1 Antibody - N-terminal region (ARP58154_P050)
Your Rating
We found other products you might like!