GSTT1 Antibody - C-terminal region (ARP48490_P050)

Catalog No: ARP48490_P050

WB Suggested Anti-GSTT1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate

Immunohistochemistry with Lung lysate tissue

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GSTT1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Dog: 86%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Rabbit: 79%; Rat: 86%
• Peptide Sequence: Synthetic peptide located within the following region: TWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GSTT1 (ARP48490_P050) antibody is Catalog # AAP48490 (Previous Catalog # AAPY01431)
• Reference: Unlu,A., (er) Cell Biochem. Funct. (2008) In press

Target Info

• Gene Symbol: GSTT1
• Gene Full Name: Glutathione S-transferase theta 1
• Alias Symbols: -
• NCBI Gene Id: 2952
• Protein Name: Glutathione S-transferase theta-1
• Description of Target: Glutathione S-transferase (GST) theta 1 (GSTT1) is a member of a superfamily of proteins that catalyze the conjugation of reduced glutathione to a variety of electrophilic and hydrophobic compounds. Human GSTs can be divided into five main classes: alpha, mu, pi, theta, and zeta. The theta class includes GSTT1 and GSTT2. The GSTT1 and GSTT2 share 55% amino acid sequence identity and both of them were claimed to have an important role in human carcinogenesis.Glutathione S-transferase (GST) theta 1 (GSTT1) is a member of a superfamily of proteins that catalyze the conjugation of reduced glutathione to a variety of electrophilic and hydrophobic compounds. Human GSTs can be divided into five main classes: alpha, mu, pi, theta, and zeta. The theta class includes GSTT1 and GSTT2. The GSTT1 and GSTT2 share 55% amino acid sequence identity and both of them were claimed to have an important role in human carcinogenesis. The GSTT1 gene is located approximately 50kb away from the GSTT2 gene. The GSTT1 and GSTT2 genes have a similar structure, being composed of five exons with identical exon/intron boundaries. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: P30711
• Protein Accession #: NP_000844
• Nucleotide Accession #: NM_000853
• Protein Size (# AA): 240
• Molecular Weight: 27kDa
• Protein Interactions: GSTO1;