GSTM5 Antibody - N-terminal region (ARP48485_P050)

Catalog No: ARP48485_P050

WB Suggested Anti-GSTM5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Muscle

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GSTM5
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Goat: 93%; Guinea Pig: 85%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 85%; Rat: 86%
• Peptide Sequence: Synthetic peptide located within the following region: MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQWLNEK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GSTM5 (ARP48485_P050) antibody is Catalog # AAP48485 (Previous Catalog # AAPY01426)

Target Info

• Gene Symbol: GSTM5
• Gene Full Name: Glutathione S-transferase mu 5
• Alias Symbols: GTM5, GSTM5-5
• NCBI Gene Id: 2949
• Protein Name: Glutathione S-transferase Mu 5
• Description of Target: Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Diversification of these genes has occurred in regions encoding substrate-binding domains, as well as in tissue expression patterns, to accommodate an increasing number of foreign compounds.
• Uniprot ID: P46439
• Protein Accession #: NP_000842
• Nucleotide Accession #: NM_000851
• Protein Size (# AA): 218
• Molecular Weight: 26kDa
• Protein Interactions: AMOTL2; GSTM5; GSTM3; UBC; PPP1CC;