Search Antibody, Protein, and ELISA Kit Solutions

GSTM1 Antibody - N-terminal region (ARP41769_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41769_P050-FITC Conjugated

ARP41769_P050-HRP Conjugated

ARP41769_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Glutathione S-transferase mu 1
NCBI Gene Id:
Protein Name:
Glutathione S-transferase Mu 5
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
GST1, GSTM1-1, GSTM1a-1a, GSTM1b-1b, GTH4, GTM1, H-B, MGC26563, MU, MU-1
Replacement Item:
This antibody may replace item sc-133641 from Santa Cruz Biotechnology.
Description of Target:
Cytosolic and membrane-bound forms of glutathione S-transferase are two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. GSTM1 a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione.Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Null mutations of this class mu gene have been linked with an increase in a number of cancers, likely due to an increased susceptibility to environmental toxins and carcinogens. Multiple protein isoforms are encoded by transcript variants of this gene.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GSTM1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GSTM1.
The immunogen is a synthetic peptide directed towards the N terminal region of human GSTM1
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%
Complete computational species homology data:
Anti-GSTM1 (ARP41769_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYI
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-GSTM1 (ARP41769_P050) antibody is Catalog # AAP41769 (Previous Catalog # AAPP10817)
Printable datasheet for anti-GSTM1 (ARP41769_P050) antibody
Target Reference:
Sobti,R.C., (2006) Cancer Genet. Cytogenet. 166 (2), 117-123

Bates, D. J. et al. MicroRNA regulation in Ames dwarf mouse liver may contribute to delayed aging. Aging Cell 9, 1-18 (2010). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 19878148

Zachut, M; Kra, G; Livshitz, L; Portnick, Y; Yakoby, S; Friedlander, G; Levin, Y; Seasonal heat stress affects adipose tissue proteome toward enrichment of the Nrf2-mediated oxidative stress response in late-pregnant dairy cows. 158, 52-61 (2017). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 28238905

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...