GSTA4 Antibody - middle region (ARP90059_P050)

Catalog No: ARP90059_P050

Host: Rabbit
Target Name: GSTA4
Sample Tissue: Mouse Testis lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -21C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse GSTA4
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: PKEKEESYDLILSRAKTRYFPVFEKILKDHGEAFLVGNQLSWADIQLLEA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GSTA4 (ARP90059_P050) antibody is Catalog # AAP90059

Target Info

• Gene Symbol: GSTA4
• Gene Full Name: glutathione S-transferase, alpha 4
• Alias Symbols: mGst, GST5.7, mGsta4
• NCBI Gene Id: 14860
• Protein Name: glutathione S-transferase A4
• Description of Target: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
• Uniprot ID: P24472
• Protein Accession #: NP_034487.2
• Nucleotide Accession #: NM_010357.3
• Protein Size (# AA): 222
• Molecular Weight: 24 kDa