Search Antibody, Protein, and ELISA Kit Solutions

GSS Antibody - C-terminal region : FITC (ARP72533_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP72533_P050 Unconjugated

ARP72533_P050-HRP Conjugated

ARP72533_P050-Biotin Conjugated

Gene Symbol:
GSS
NCBI Gene Id:
2937
Swissprot Id:
P48637
Protein Accession #:
XP_005260463
Alias Symbols:
GSS,
Replacement Item:
This antibody may replace item sc-15090 from Santa Cruz Biotechnology.
Description of Target:
Glutathione is important for a variety of biological functions, including protection of cells from oxidative damage by free radicals, detoxification of xenobiotics, and membrane transport. The protein encoded by this gene functions as a homodimer to catalyze the second step of glutathione biosynthesis, which is the ATP-dependent conversion of gamma-L-glutamyl-L-cysteine to glutathione. Defects in this gene are a cause of glutathione synthetase deficiency.
Protein Size (# AA):
474
Molecular Weight:
52kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GSS.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GSS.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human GSS
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Peptide Sequence:
Synthetic peptide located within the following region: EEGDQAIAEALAAPSRFVLKPQREGGGNNLYGEEMVQALKQLKDSEERAS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
GSS; UBC; GINS3; OLA1; DCPS; ABHD14A; RRAGB; PDIA4; USP14; YWHAH; YWHAG; YWHAE; YWHAB; VCL; RAP1GDS1; PPP5C; PAFAH1B2; MVK; MSN; HMGB3; ECHS1; TBCB; ASS1; ASNS; CDK9; TERF1; GSTZ1;
Blocking Peptide:
For anti-GSS (ARP72533_P050-FITC) antibody is Catalog # AAP72533
Datasheets/Manuals:
Printable datasheet for anti-GSS (ARP72533_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...