Search Antibody, Protein, and ELISA Kit Solutions

GSR Antibody - N-terminal region (ARP54344_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP54344_P050-FITC Conjugated

ARP54344_P050-HRP Conjugated

ARP54344_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Mouse, Zebrafish
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-133159 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the N terminal region of human GSR
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93%
Complete computational species homology data:
Anti-GSR (ARP54344_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-GSR (ARP54344_P050) antibody is Catalog # AAP54344 (Previous Catalog # AAPP31092)
Printable datasheet for anti-GSR (ARP54344_P050) antibody
Sample Type Confirmation:

GSR is supported by BioGPS gene expression data to be expressed in 721_B, HepG2

Target Reference:
Senturk,M., (2008) J Enzyme Inhib Med Chem 23 (1), 144-148
Gene Symbol:
Official Gene Full Name:
Glutathione reductase
Alias Symbols:
NCBI Gene Id:
Protein Name:
Glutathione reductase, mitochondrial
Description of Target:
GSR belongs to the class-I pyridine nucleotide-disulfide oxidoreductase family. It maintains high levels of reduced glutathione in the cytosol. Both glutathione and glutathione reductase are inducible by D3T, and that upregulation of GSH biosynthesis underlies D3T-mediated cytoprotection against ROS/RNS-elicited injury to human vascular smooth muscle cells.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GSR.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GSR.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...