Catalog No: ARP54344_P050
Price: $0.00
SKU
ARP54344_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-GSR (ARP54344_P050) antibody
Product Info
Tested Species ReactivityHuman, Mouse, Zebrafish
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human GSR
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP
Concentration0.5 mg/ml
Blocking PeptideFor anti-GSR (ARP54344_P050) antibody is Catalog # AAP54344 (Previous Catalog # AAPP31092)
Sample Type Confirmation

GSR is supported by BioGPS gene expression data to be expressed in 721_B, HepG2

ReferenceSenturk,M., (2008) J Enzyme Inhib Med Chem 23 (1), 144-148
Gene SymbolGSR
Gene Full NameGlutathione reductase
Alias SymbolsGR, GSRD, HEL-75, HEL-S-122m
NCBI Gene Id2936
Protein NameGlutathione reductase, mitochondrial
Description of TargetGSR belongs to the class-I pyridine nucleotide-disulfide oxidoreductase family. It maintains high levels of reduced glutathione in the cytosol. Both glutathione and glutathione reductase are inducible by D3T, and that upregulation of GSH biosynthesis underlies D3T-mediated cytoprotection against ROS/RNS-elicited injury to human vascular smooth muscle cells.
Uniprot IDP00390
Protein Accession #NP_000628
Nucleotide Accession #NM_000637
Protein Size (# AA)522
Molecular Weight56kDa
Protein InteractionsSUMO1; CNDP2; GINS2; PROSC; AHSA1; NDRG1; DDX39A; NAMPT; KYNU; DDX39B; RPS6KA1; PEPD; MVD; LDHA; HSPD1; GBP2; EEF2; ADSS; C11orf49; UBC; FOLR1; ISG15; ELAVL1; SUMO4; PJA1; OCM; GSR;
  1. What is the species homology for "GSR Antibody - N-terminal region (ARP54344_P050)"?

    The tested species reactivity for this item is "Human, Mouse, Zebrafish". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "GSR Antibody - N-terminal region (ARP54344_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GSR Antibody - N-terminal region (ARP54344_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GSR Antibody - N-terminal region (ARP54344_P050)"?

    This target may also be called "GR, GSRD, HEL-75, HEL-S-122m" in publications.

  5. What is the shipping cost for "GSR Antibody - N-terminal region (ARP54344_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GSR Antibody - N-terminal region (ARP54344_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GSR Antibody - N-terminal region (ARP54344_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "56kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GSR Antibody - N-terminal region (ARP54344_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "GSR"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GSR"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GSR"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GSR"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GSR"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GSR"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GSR Antibody - N-terminal region (ARP54344_P050)
Your Rating
We found other products you might like!