Now Offering Over 102,157 Antibodies & 44,722 Antigens!

GSR antibody - N-terminal region (ARP54344_P050)

100 ul
$319.00
In Stock

Conjugation Options

ARP54344_P050-FITC Conjugated

ARP54344_P050-HRP Conjugated

ARP54344_P050-Biotin Conjugated

Gene Symbol:
GSR
NCBI Gene Id:
2936
Official Gene Full Name:
Glutathione reductase
Protein Name:
Glutathione reductase, mitochondrial
Swissprot Id:
P00390
Protein Accession #:
NP_000628
Nucleotide Accession #:
NM_000637
Alias Symbols:
MGC78522
Replacement Item:
This antibody may replace item sc-133159 from Santa Cruz Biotechnology.
Description of Target:
GSR belongs to the class-I pyridine nucleotide-disulfide oxidoreductase family. It maintains high levels of reduced glutathione in the cytosol. Both glutathione and glutathione reductase are inducible by D3T, and that upregulation of GSH biosynthesis underlies D3T-mediated cytoprotection against ROS/RNS-elicited injury to human vascular smooth muscle cells.
Protein Size (# AA):
522
Molecular Weight:
56kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GSR.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GSR.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human GSR
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93%
Complete computational species homology data:
Anti-GSR (ARP54344_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SUMO1; CNDP2; GINS2; PROSC; AHSA1; NDRG1; DDX39A; NAMPT; KYNU; DDX39B; RPS6KA1; PEPD; MVD; LDHA; HSPD1; GBP2; EEF2; ADSS; C11orf49; UBC; FOLR1; ISG15; ELAVL1; SUMO4; PJA1; OCM; GSR;
Blocking Peptide:
For anti-GSR (ARP54344_P050) antibody is Catalog # AAP54344 (Previous Catalog # AAPP31092)
Datasheets/Manuals:
Printable datasheet for anti-GSR (ARP54344_P050) antibody
Sample Type Confirmation:

GSR is supported by BioGPS gene expression data to be expressed in 721_B, HepG2

Target Reference:
Senturk,M., (2008) J Enzyme Inhib Med Chem 23 (1), 144-148

Tell us what you think about this item!

Write A Review
    Please, wait...