Catalog No: ARP55356_P050
Price: $0.00
SKU
ARP55356_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-GSPT2 (ARP55356_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Horse, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human GSPT2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHorse: 86%; Human: 100%; Mouse: 86%; Pig: 86%; Rat: 86%
Peptide SequenceSynthetic peptide located within the following region: MALEESWEHSKEVSEAEPGGGSSGDSGPPEESGQEMMEEKEEIRKSKSVI
Concentration0.5 mg/ml
Blocking PeptideFor anti-GSPT2 (ARP55356_P050) antibody is Catalog # AAP55356 (Previous Catalog # AAPP33228)
SubunitERF3B
ReferenceChauvin,C., (2005) Mol. Cell. Biol. 25 (14), 5801-5811
Gene SymbolGSPT2
Gene Full NameG1 to S phase transition 2
Alias SymbolsGST2, ERF3B
NCBI Gene Id23708
Protein NameEukaryotic peptide chain release factor GTP-binding subunit ERF3B
Description of TargetGSPT2 is closely related to GSPT1, a GTP-binding protein that plays an essential role at the G1- to S-phase transition of the cell cycle in yeast and human cells. GSPT1 is a positive regulator of translational accuracy and, in a binary complex with eRF1, functions as a polypeptide chain release factor.GSPT2 is closely related to GSPT1 (MIM 139259), a GTP-binding protein that plays an essential role at the G1- to S-phase transition of the cell cycle in yeast and human cells. GSPT1 is a positive regulator of translational accuracy and, in a binary complex with eRF1 (MIM 600285), functions as a polypeptide chain release factor.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-207 BC036077.1 1-207 208-1527 AJ251548.1 12-1331 1528-2497 AK001303.1 1512-2481 2498-2503 AK023155.1 2487-2492
Uniprot IDQ8IYD1
Protein Accession #NP_060564
Nucleotide Accession #NM_018094
Protein Size (# AA)628
Molecular Weight69kDa
Protein InteractionsUBC; ATG7; STAT1; SNX2; SNX1; SHMT2; SHMT1; RDX; NASP; IDE; GSPT1; CTTN; ATP6V1C1; UPF1; PABPC1; SMG1; CCT2; APP; UBR5; ETF1;
  1. What is the species homology for "GSPT2 Antibody - N-terminal region (ARP55356_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Horse, Pig".

  2. How long will it take to receive "GSPT2 Antibody - N-terminal region (ARP55356_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GSPT2 Antibody - N-terminal region (ARP55356_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GSPT2 Antibody - N-terminal region (ARP55356_P050)"?

    This target may also be called "GST2, ERF3B" in publications.

  5. What is the shipping cost for "GSPT2 Antibody - N-terminal region (ARP55356_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GSPT2 Antibody - N-terminal region (ARP55356_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GSPT2 Antibody - N-terminal region (ARP55356_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "69kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GSPT2 Antibody - N-terminal region (ARP55356_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "GSPT2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GSPT2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GSPT2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GSPT2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GSPT2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GSPT2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GSPT2 Antibody - N-terminal region (ARP55356_P050)
Your Rating
We found other products you might like!