GSPT2 Antibody - N-terminal region (ARP55356_P050)

Catalog No: ARP55356_P050

WB Suggested Anti-GSPT2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Horse, Pig
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GSPT2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Horse: 86%; Human: 100%; Mouse: 86%; Pig: 86%; Rat: 86%
• Peptide Sequence: Synthetic peptide located within the following region: MALEESWEHSKEVSEAEPGGGSSGDSGPPEESGQEMMEEKEEIRKSKSVI
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GSPT2 (ARP55356_P050) antibody is Catalog # AAP55356 (Previous Catalog # AAPP33228)
• Subunit: ERF3B
• Reference: Chauvin,C., (2005) Mol. Cell. Biol. 25 (14), 5801-5811

Target Info

• Gene Symbol: GSPT2
• Gene Full Name: G1 to S phase transition 2
• Alias Symbols: GST2, ERF3B
• NCBI Gene Id: 23708
• Protein Name: Eukaryotic peptide chain release factor GTP-binding subunit ERF3B
• Description of Target: GSPT2 is closely related to GSPT1, a GTP-binding protein that plays an essential role at the G1- to S-phase transition of the cell cycle in yeast and human cells. GSPT1 is a positive regulator of translational accuracy and, in a binary complex with eRF1, functions as a polypeptide chain release factor.GSPT2 is closely related to GSPT1 (MIM 139259), a GTP-binding protein that plays an essential role at the G1- to S-phase transition of the cell cycle in yeast and human cells. GSPT1 is a positive regulator of translational accuracy and, in a binary complex with eRF1 (MIM 600285), functions as a polypeptide chain release factor.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-207 BC036077.1 1-207 208-1527 AJ251548.1 12-1331 1528-2497 AK001303.1 1512-2481 2498-2503 AK023155.1 2487-2492
• Uniprot ID: Q8IYD1
• Protein Accession #: NP_060564
• Nucleotide Accession #: NM_018094
• Protein Size (# AA): 628
• Molecular Weight: 69kDa
• Protein Interactions: UBC; ATG7; STAT1; SNX2; SNX1; SHMT2; SHMT1; RDX; NASP; IDE; GSPT1; CTTN; ATP6V1C1; UPF1; PABPC1; SMG1; CCT2; APP; UBR5; ETF1;