- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-GSPT2 (ARP55356_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Horse, Pig |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GSPT2 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Horse: 86%; Human: 100%; Mouse: 86%; Pig: 86%; Rat: 86% |
Peptide Sequence | Synthetic peptide located within the following region: MALEESWEHSKEVSEAEPGGGSSGDSGPPEESGQEMMEEKEEIRKSKSVI |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-GSPT2 (ARP55356_P050) antibody is Catalog # AAP55356 (Previous Catalog # AAPP33228) |
Subunit | ERF3B |
Reference | Chauvin,C., (2005) Mol. Cell. Biol. 25 (14), 5801-5811 |
---|---|
Gene Symbol | GSPT2 |
Gene Full Name | G1 to S phase transition 2 |
Alias Symbols | GST2, ERF3B |
NCBI Gene Id | 23708 |
Protein Name | Eukaryotic peptide chain release factor GTP-binding subunit ERF3B |
Description of Target | GSPT2 is closely related to GSPT1, a GTP-binding protein that plays an essential role at the G1- to S-phase transition of the cell cycle in yeast and human cells. GSPT1 is a positive regulator of translational accuracy and, in a binary complex with eRF1, functions as a polypeptide chain release factor.GSPT2 is closely related to GSPT1 (MIM 139259), a GTP-binding protein that plays an essential role at the G1- to S-phase transition of the cell cycle in yeast and human cells. GSPT1 is a positive regulator of translational accuracy and, in a binary complex with eRF1 (MIM 600285), functions as a polypeptide chain release factor.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-207 BC036077.1 1-207 208-1527 AJ251548.1 12-1331 1528-2497 AK001303.1 1512-2481 2498-2503 AK023155.1 2487-2492 |
Uniprot ID | Q8IYD1 |
Protein Accession # | NP_060564 |
Nucleotide Accession # | NM_018094 |
Protein Size (# AA) | 628 |
Molecular Weight | 69kDa |
Protein Interactions | UBC; ATG7; STAT1; SNX2; SNX1; SHMT2; SHMT1; RDX; NASP; IDE; GSPT1; CTTN; ATP6V1C1; UPF1; PABPC1; SMG1; CCT2; APP; UBR5; ETF1; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "GSPT2 Antibody - N-terminal region (ARP55356_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Horse, Pig".
-
How long will it take to receive "GSPT2 Antibody - N-terminal region (ARP55356_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "GSPT2 Antibody - N-terminal region (ARP55356_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "GSPT2 Antibody - N-terminal region (ARP55356_P050)"?
This target may also be called "GST2, ERF3B" in publications.
-
What is the shipping cost for "GSPT2 Antibody - N-terminal region (ARP55356_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "GSPT2 Antibody - N-terminal region (ARP55356_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "GSPT2 Antibody - N-terminal region (ARP55356_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "69kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "GSPT2 Antibody - N-terminal region (ARP55356_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "GSPT2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "GSPT2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "GSPT2"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "GSPT2"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "GSPT2"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "GSPT2"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.