Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

GSN Antibody - C-terminal region (ARP54299_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP54299_P050-FITC Conjugated

ARP54299_P050-HRP Conjugated

ARP54299_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
NCBI Gene Id:
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
DKFZp313L0718, ADF, AGEL
Replacement Item:
This antibody may replace item sc-126909 from Santa Cruz Biotechnology.
Description of Target:
GSN binds to the 'plus' ends of actin monomers and filaments to prevent monomer exchange. It is a calcium-regulated protein, which functions in both assembly and disassembly of actin filaments. Defects in the gene encoding GSN are a cause of familial amyloidosis Finnish type (FAF).The protein encoded by this gene binds to the 'plus' ends of actin monomers and filaments to prevent monomer exchange. The encoded calcium-regulated protein functions in both assembly and disassembly of actin filaments. Defects in this gene are a cause of familial amyloidosis Finnish type (FAF). Multiple transcript variants encoding several different isoforms have been found for this gene.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GSN.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GSN.
The immunogen is a synthetic peptide directed towards the C terminal region of human GSN
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-GSN (ARP54299_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-GSN (ARP54299_P050) antibody is Catalog # AAP54299 (Previous Catalog # AAPP31048)
Printable datasheet for anti-GSN (ARP54299_P050) antibody
Target Reference:
Shokouhi,G. Nephrol. Dial. Transplant. 23 (3), 1071 (2008)

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...