Catalog No: ARP54644_P050
Price: $0.00
SKU
ARP54644_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

GSK3B Antibody - C-terminal region (ARP54644_P050)

Datasheets/ManualsPrintable datasheet for anti-GSK3B (ARP54644_P050) antibody
Product Info
ReferenceIzumi,N., (2008) J. Biol. Chem. 283 (19), 12981-12991
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: Paraffin embedded brain, cortex tissue, tested with an antibody dilution of 2.5 ug/ml.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human GSK3B
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Goat: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: AIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNF
Concentration0.5 mg/ml
Blocking PeptideFor anti-GSK3B (ARP54644_P050) antibody is Catalog # AAP54644 (Previous Catalog # AAPP31435)
Sample Type Confirmation

GSK3B is supported by BioGPS gene expression data to be expressed in 721_B, HeLa

Gene SymbolGSK3B
Gene Full NameGlycogen synthase kinase 3 beta
Alias Symbols-
NCBI Gene Id2932
Protein NameGlycogen synthase kinase-3 beta
Description of TargetGlycogen synthase kinase-3 (GSK3) is a proline-directed serine-threonine kinase that was initially identified as a phosphorylating and inactivating glycogen synthase. Two isoforms, alpha (GSK3A) and beta, show a high degree of amino acid homology. GSK3B is involved in energy metabolism, neuronal cell development, and body pattern formation.Glycogen synthase kinase-3 (GSK3) is a proline-directed serine-threonine kinase that was initially identified as a phosphorylating and inactivating glycogen synthase. Two isoforms, alpha (GSK3A; MIM 606784) and beta, show a high degree of amino acid homology (Stambolic and Woodgett, 1994 [PubMed 7980435]). GSK3B is involved in energy metabolism, neuronal cell development, and body pattern formation (Plyte et al., 1992 [PubMed 1333807]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP49841
Protein Accession #NP_002084
Nucleotide Accession #NM_002093
Protein Size (# AA)433
Molecular Weight48kDa
Protein InteractionsAKT1; MAP3K4; MAPT; JUN; RNF220; HDAC4; AXIN1; SNAI2; NBR1; AURKA; UBC; axl-1; pry-1; PRKAR1A; EYA1; GSK3B; AKAP11; BTRC; CTNNB1; HECW2; PRKACA; PPP1R2; APC; FRAT1; AXIN2; GSKIP; LRP6; CSF3R; DYNLL1; VIM; FRAT2; EPB41L3; CLASP2; HSP90AA1; PPP1CA; PRUNE; N
  1. What is the species homology for "GSK3B Antibody - C-terminal region (ARP54644_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish".

  2. How long will it take to receive "GSK3B Antibody - C-terminal region (ARP54644_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GSK3B Antibody - C-terminal region (ARP54644_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GSK3B Antibody - C-terminal region (ARP54644_P050)"?

    This target may also be called "-" in publications.

  5. What is the shipping cost for "GSK3B Antibody - C-terminal region (ARP54644_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GSK3B Antibody - C-terminal region (ARP54644_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GSK3B Antibody - C-terminal region (ARP54644_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "48kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GSK3B Antibody - C-terminal region (ARP54644_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "GSK3B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GSK3B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GSK3B"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GSK3B"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GSK3B"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GSK3B"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GSK3B Antibody - C-terminal region (ARP54644_P050)
Your Rating
We found other products you might like!