Search Antibody, Protein, and ELISA Kit Solutions

GRPR Antibody - N-terminal region : FITC (ARP76236_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP76236_P050 Unconjugated

ARP76236_P050-HRP Conjugated

ARP76236_P050-Biotin Conjugated

Gene Symbol:
GRPR
NCBI Gene Id:
2925
Swissprot Id:
P30550
Protein Accession #:
NP_005305
Alias Symbols:
GRPR,
Replacement Item:
This antibody may replace item sc-110069 from Santa Cruz Biotechnology.
Description of Target:
Gastrin-releasing peptide (GRP) regulates numerous functions of the gastrointestinal and central nervous systems, including release of gastrointestinal hormones, smooth muscle cell contraction, and epithelial cell proliferation and is a potent mitogen for neoplastic tissues. The effects of GRP are mediated through the gastrin-releasing peptide receptor. This receptor is a glycosylated, 7-transmembrane G-protein coupled receptor that activates the phospholipase C signaling pathway. The receptor is aberrantly expressed in numerous cancers such as those of the lung, colon, and prostate. An individual with autism and multiple exostoses was found to have a balanced translocation between chromosome 8 and a chromosome X breakpoint located within the gastrin-releasing peptide receptor gene.
Protein Size (# AA):
384
Molecular Weight:
43kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GRPR.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GRPR.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human GRPR
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: FLLNLEVDHFMHCNISSHSADLPVNDDWSHPGILYVIPAVYGVIILIGLI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Blocking Peptide:
For anti-GRPR (ARP76236_P050-FITC) antibody is Catalog # AAP76226
Datasheets/Manuals:
Printable datasheet for anti-GRPR (ARP76236_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...