GRPEL2 Antibody - middle region (ARP52949_P050)

Catalog No: ARP52949_P050

WB Suggested Anti-GRPEL2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GRPEL2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
• Peptide Sequence: Synthetic peptide located within the following region: HEHELICHVPAGVGVQPGTVALVRQDGYKLHGRTIRLARVEVAVESQRRL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GRPEL2 (ARP52949_P050) antibody is Catalog # AAP52949 (Previous Catalog # AAPP35003)
• Reference: Naylor,D.J., (1998) J. Biol. Chem. 273 (33), 21169-21177

Target Info

• Gene Symbol: GRPEL2
• Gene Full Name: GrpE-like 2, mitochondrial (E. coli)
• Alias Symbols: Mt-GrpE#2
• NCBI Gene Id: 134266
• Protein Name: GrpE protein homolog 2, mitochondrial
• Description of Target: GRPEL2 is an essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. GRPEL2 seems to control the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins. GRPEL2 stimulates ATPase activity of mt-HSP70. GRPEL2 may also serve to modulate the interconversion of oligomeric (inactive) and monomeric (active) forms of mt-HSP70.
• Uniprot ID: Q8TAA5
• Protein Accession #: NP_689620
• Nucleotide Accession #: NM_152407
• Protein Size (# AA): 225
• Molecular Weight: 25kDa
• Protein Interactions: ELAVL1; UBC; HSPA4;