Catalog No: ARP37674_P050-FITC
Size:100ul
Price: $434.00
SKU
ARP37674_P050-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

GRIK5 Antibody : FITC (ARP37674_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-GRIK5 (ARP37674_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB, IHC
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human GRIK5
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: EDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFM
Concentration0.5 mg/ml
Blocking PeptideFor anti-GRIK5 (ARP37674_P050-FITC) antibody is Catalog # AAP37674 (Previous Catalog # AAPP09008)
Sample Type Confirmation

GRIK5 is supported by BioGPS gene expression data to be expressed in Jurkat

ReferenceShibata,H., (2006) Psychiatry Res 141 (1), 39-51
Gene SymbolGRIK5
Gene Full NameGlutamate receptor, ionotropic, kainate 5
Alias SymbolsKA2, EAA2, GRIK2, GluK5
NCBI Gene Id2901
Protein NameGlutamate receptor, ionotropic kainate 5
Description of TargetGRIK5 is a protein that belongs to the glutamate-gated ionic channel family. Glutamate functions as the major excitatory neurotransmitter in the central nervous system through activation of ligand-gated ion channels and G protein-coupled membrane receptors. GRIK5 forms functional heteromeric kainate-preferring ionic channels with the subunits encoded by related gene family members.This gene encodes a protein that belongs to the glutamate-gated ionic channel family. Glutamate functions as the major excitatory neurotransmitter in the central nervous system through activation of ligand-gated ion channels and G protein-coupled membrane receptors. The protein encoded by this gene forms functional heteromeric kainate-preferring ionic channels with the subunits encoded by related gene family members. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDQ16478
Protein Accession #NP_002079
Nucleotide Accession #NM_002088
Protein Size (# AA)980
Molecular Weight108kDa
Protein InteractionsLRSAM1; GOLM1; GRID2; GPAA1; DLG4; MLF1; GRIK2; GRIK3; DLG3; GRIA2;
  1. What is the species homology for "GRIK5 Antibody : FITC (ARP37674_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "GRIK5 Antibody : FITC (ARP37674_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GRIK5 Antibody : FITC (ARP37674_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GRIK5 Antibody : FITC (ARP37674_P050-FITC)"?

    This target may also be called "KA2, EAA2, GRIK2, GluK5" in publications.

  5. What is the shipping cost for "GRIK5 Antibody : FITC (ARP37674_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GRIK5 Antibody : FITC (ARP37674_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GRIK5 Antibody : FITC (ARP37674_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "108kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GRIK5 Antibody : FITC (ARP37674_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "GRIK5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GRIK5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GRIK5"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GRIK5"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GRIK5"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GRIK5"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GRIK5 Antibody : FITC (ARP37674_P050-FITC)
Your Rating
We found other products you might like!