GRIK5 Antibody : Biotin (ARP37674_P050-Biotin)

Catalog No: ARP37674_P050-Biotin

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: Biotin
• Application: WB, IHC
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GRIK5
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: EDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFM
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GRIK5 (ARP37674_P050-Biotin) antibody is Catalog # AAP37674 (Previous Catalog # AAPP09008)
• Sample Type Confirmation:

  GRIK5 is supported by BioGPS gene expression data to be expressed in Jurkat

• Reference: Shibata,H., (2006) Psychiatry Res 141 (1), 39-51

Target Info

• Gene Symbol: GRIK5
• Gene Full Name: Glutamate receptor, ionotropic, kainate 5
• Alias Symbols: KA2, EAA2, GRIK2, GluK5
• NCBI Gene Id: 2901
• Protein Name: Glutamate receptor, ionotropic kainate 5
• Description of Target: GRIK5 is a protein that belongs to the glutamate-gated ionic channel family. Glutamate functions as the major excitatory neurotransmitter in the central nervous system through activation of ligand-gated ion channels and G protein-coupled membrane receptors. GRIK5 forms functional heteromeric kainate-preferring ionic channels with the subunits encoded by related gene family members.This gene encodes a protein that belongs to the glutamate-gated ionic channel family. Glutamate functions as the major excitatory neurotransmitter in the central nervous system through activation of ligand-gated ion channels and G protein-coupled membrane receptors. The protein encoded by this gene forms functional heteromeric kainate-preferring ionic channels with the subunits encoded by related gene family members. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: Q16478
• Protein Accession #: NP_002079
• Nucleotide Accession #: NM_002088
• Protein Size (# AA): 980
• Molecular Weight: 108kDa
• Protein Interactions: LRSAM1; GOLM1; GRID2; GPAA1; DLG4; MLF1; GRIK2; GRIK3; DLG3; GRIA2;