Search Antibody, Protein, and ELISA Kit Solutions

GRIK5 Antibody (ARP37674_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP37674_P050-FITC Conjugated

ARP37674_P050-HRP Conjugated

ARP37674_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Glutamate receptor, ionotropic, kainate 5
Protein Name:
Glutamate receptor, ionotropic kainate 5
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
EAA2, GRIK2, KA2, GluK5
Replacement Item:
This antibody may replace item sc-42496 from Santa Cruz Biotechnology.
Description of Target:
GRIK5 is a protein that belongs to the glutamate-gated ionic channel family. Glutamate functions as the major excitatory neurotransmitter in the central nervous system through activation of ligand-gated ion channels and G protein-coupled membrane receptors. GRIK5 forms functional heteromeric kainate-preferring ionic channels with the subunits encoded by related gene family members.This gene encodes a protein that belongs to the glutamate-gated ionic channel family. Glutamate functions as the major excitatory neurotransmitter in the central nervous system through activation of ligand-gated ion channels and G protein-coupled membrane receptors. The protein encoded by this gene forms functional heteromeric kainate-preferring ionic channels with the subunits encoded by related gene family members. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GRIK5.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GRIK5.
The immunogen is a synthetic peptide directed towards the middle region of human GRIK5
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-GRIK5 (ARP37674_P050 )
Peptide Sequence:
Synthetic peptide located within the following region: EDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFM
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-GRIK5 (ARP37674_P050) antibody is Catalog # AAP37674 (Previous Catalog # AAPP09008)
Printable datasheet for anti-GRIK5 (ARP37674_P050) antibody
Sample Type Confirmation:

GRIK5 is supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
Shibata,H., (2006) Psychiatry Res 141 (1), 39-51

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...