Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
ARP37674_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP37674_P050-FITC Conjugated

ARP37674_P050-HRP Conjugated

ARP37674_P050-Biotin Conjugated

GRIK5 Antibody (ARP37674_P050)

Catalog#: ARP37674_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IHC
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-42496 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human GRIK5
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology dataAnti-GRIK5 (ARP37674_P050 )
Peptide SequenceSynthetic peptide located within the following region: EDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFM
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-GRIK5 (ARP37674_P050) antibody is Catalog # AAP37674 (Previous Catalog # AAPP09008)
Datasheets/ManualsPrintable datasheet for anti-GRIK5 (ARP37674_P050) antibody
Sample Type Confirmation

GRIK5 is supported by BioGPS gene expression data to be expressed in Jurkat

Target ReferenceShibata,H., (2006) Psychiatry Res 141 (1), 39-51
Gene SymbolGRIK5
Official Gene Full NameGlutamate receptor, ionotropic, kainate 5
Alias SymbolsEAA2, GRIK2, KA2, GluK5
NCBI Gene Id2901
Protein NameGlutamate receptor, ionotropic kainate 5
Description of TargetGRIK5 is a protein that belongs to the glutamate-gated ionic channel family. Glutamate functions as the major excitatory neurotransmitter in the central nervous system through activation of ligand-gated ion channels and G protein-coupled membrane receptors. GRIK5 forms functional heteromeric kainate-preferring ionic channels with the subunits encoded by related gene family members.This gene encodes a protein that belongs to the glutamate-gated ionic channel family. Glutamate functions as the major excitatory neurotransmitter in the central nervous system through activation of ligand-gated ion channels and G protein-coupled membrane receptors. The protein encoded by this gene forms functional heteromeric kainate-preferring ionic channels with the subunits encoded by related gene family members. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot IdQ16478
Protein Accession #NP_002079
Nucleotide Accession #NM_002088
Protein Size (# AA)980
Molecular Weight108kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express GRIK5.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express GRIK5.
Protein InteractionsLRSAM1; GOLM1; GRID2; GPAA1; DLG4; MLF1; GRIK2; GRIK3; DLG3; GRIA2;
Write Your Own Review
You're reviewing:GRIK5 Antibody (ARP37674_P050)
Your Rating
Assay Development
Aviva Tips and Tricks
Aviva Validation Data
Free Microscope