Search Antibody, Protein, and ELISA Kit Solutions

GRIK2 antibody - N-terminal region (ARP35515_T100)

100 ul
$249.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP35515_T100-FITC Conjugated

ARP35515_T100-HRP Conjugated

ARP35515_T100-Biotin Conjugated

Gene Symbol:
GRIK2
NCBI Gene Id:
2898
Official Gene Full Name:
Glutamate receptor, ionotropic, kainate 2
Protein Name:
Glutamate receptor, ionotropic kainate 2
Swissprot Id:
Q13002
Replacement Item:
This antibody may replace item sc-37106 from Santa Cruz Biotechnology.
Description of Target:
The GRIK2 gene encodes a subunit of a kainate glutamate receptor. Glutamate receptors mediate the majority of excitatory neurotransmission in the brain. This receptor may have a role in synaptic plasticity and may be important for learning and memory. It also may be involved in the transmission of light information from the retina to the hypothalamus. The structure and function of the encoded protein is changed by RNA editing.
Protein Size (# AA):
908
Molecular Weight:
102kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GRIK2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GRIK2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human GRIK2
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-GRIK2 (ARP35515_T100)
Peptide Sequence:
Synthetic peptide located within the following region: PDFSSLSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
CALCOCO1; TRIM25; PICK1; DLG4; LIN7B; GRID2; PRKAA1; SDCBP; CTNND1; DLG1; GRIK5; GRIK4; DLG3; CASK; GRIA1; GRIK2; CTNNB1; CDH2; GRIP1; GRIA2;
Blocking Peptide:
For anti-GRIK2 (ARP35515_T100) antibody is Catalog # AAP35515 (Previous Catalog # AAPP07288)
Datasheets/Manuals:
Printable datasheet for anti-GRIK2 (ARP35515_T100) antibody
Target Reference:
Delorme,R., et al., (2004) 15 (4), 699-702
Publications:

Funk, J. A. et al. Characterization of renal toxicity in mice administered the marine biotoxin domoic Acid. J. Am. Soc. Nephrol. 25, 1187-97 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 24511141

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...