GRIK2 Antibody - middle region : FITC (ARP76226_P050-FITC)

Catalog No: ARP76226_P050-FITC

Size:100ul

Product Info

• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human GRIK2
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: LGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLY
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GRIK2 (ARP76226_P050-FITC) antibody is Catalog # AAP76226
• Reference: N/A

Target Info

• Gene Symbol: GRIK2
• Alias Symbols: EAA4, GLR6, MRT6, GLUK6, GLUR6, GluK2
• NCBI Gene Id: 2898
• Description of Target: Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. This gene product belongs to the kainate family of glutamate receptors, which are composed of four subunits and function as ligand-activated ion channels. The subunit encoded by this gene is subject to RNA editing at multiple sites within the first and second transmembrane domains, which is thought to alter the structure and function of the receptor complex. Alternatively spliced transcript variants encoding different isoforms have also been described for this gene. Mutations in this gene have been associated with autosomal recessive mental retardation.
• Uniprot ID: Q13002-3
• Protein Size (# AA): 584
• Molecular Weight: 64kDa