GRIA4 Antibody - middle region : FITC (ARP76224_P050-FITC)

Catalog No: ARP76224_P050-FITC

Size:100ul

Product Info

• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human GRIA4
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: RFIHGGANVTGFQLVDFNTPMVIKLMDRWKKLDQREYPGSETPPKYTSAL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GRIA4 (ARP76224_P050-FITC) antibody is Catalog # AAP76224
• Reference: N/A

Target Info

• Gene Symbol: GRIA4
• Alias Symbols: GLUR4, GLURD, GluA4, GLUR4C, NEDSGA
• NCBI Gene Id: 2893
• Description of Target: Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. These receptors are heteromeric protein complexes composed of multiple subunits, arranged to form ligand-gated ion channels. The classification of glutamate receptors is based on their activation by different pharmacologic agonists. The subunit encoded by this gene belongs to a family of AMPA (alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate)-sensitive glutamate receptors, and is subject to RNA editing (AGA->GGA; R->G). Alternative splicing of this gene results in transcript variants encoding different isoforms, which may vary in their signal transduction properties. Some haplotypes of this gene show a positive association with schizophrenia.
• Uniprot ID: P48058-2
• Protein Size (# AA): 433
• Molecular Weight: 47kDa