Search Antibody, Protein, and ELISA Kit Solutions

GRHPR Antibody - middle region (ARP85259_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
GRHPR
Official Gene Full Name:
glyoxylate reductase/hydroxypyruvate reductase
NCBI Gene Id:
9380
Protein Name:
glyoxylate reductase/hydroxypyruvate reductase
Swissprot Id:
Q9UBQ7-2
Protein Accession #:
NP_036335.1
Nucleotide Accession #:
NM_012203.1
Alias Symbols:
PH2, GLXR, GLYD
Description of Target:
This gene encodes an enzyme with hydroxypyruvate reductase, glyoxylate reductase, and D-glycerate dehydrogenase enzymatic activities. The enzyme has widespread tissue expression and has a role in metabolism. Type II hyperoxaluria is caused by mutations in this gene.
Protein Size (# AA):
252
Molecular Weight:
28 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GRHPR.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GRHPR.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human GRHPR
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: CGYGLTQSTVGIIGLGRIGQAIARRLKPFGVQRFLYTGRQPRPEEAAEFQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-GRHPR (ARP85259_P050) antibody is Catalog # AAP85259
Datasheets/Manuals:
Printable datasheet for anti-GRHPR (ARP85259_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...