Search Antibody, Protein, and ELISA Kit Solutions

GRHL3 Antibody - C-terminal region (ARP39489_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP39489_P050-FITC Conjugated

ARP39489_P050-HRP Conjugated

ARP39489_P050-Biotin Conjugated

Gene Symbol:
GRHL3
Official Gene Full Name:
Grainyhead-like 3 (Drosophila)
NCBI Gene Id:
57822
Protein Name:
Grainyhead-like protein 3 homolog
Swissprot Id:
Q8TE85-4
Protein Accession #:
NP_937817
Nucleotide Accession #:
NM_198174
Alias Symbols:
SOM, TFCP2L4
Replacement Item:
This antibody may replace item sc-101968 from Santa Cruz Biotechnology.
Description of Target:
GRHL3 is a member of the grainyhead family of transcription factors. GRHL3 interacts with leader-binding protein 32 (LBP-32) and brother of mammalian grainyhead (BOM), and may function as a transcription factor during development. Multiple transcript variants encoding distinct isoforms have been identified for this gene. This gene encodes a member of the grainyhead family of transcription factors. The encoded protein interacts with leader-binding protein 32 (LBP-32) and brother of mammalian grainyhead (BOM), and may function as a transcription factor during development. Multiple transcript variants encoding distinct isoforms have been identified for this gene. Additional transcript variants have been described, but their biological nature has not been determined.
Protein Size (# AA):
509
Molecular Weight:
57kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB, ChIP
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GRHL3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GRHL3.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human GRHL3
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 100%; Rat: 93%
Complete computational species homology data:
Anti-GRHL3 (ARP39489_P050)
Peptide Sequence:
Synthetic peptide located within the following region: EEVFDALMLKTPDLKGLRNAISEKYGFPEENIYKVYKKCKRGILVNMDNN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
PRMT6; PRMT5; PRMT1; GRHL1; GRHL3; GRHL2;
Blocking Peptide:
For anti-GRHL3 (ARP39489_P050) antibody is Catalog # AAP39489 (Previous Catalog # AAPP21506)
Datasheets/Manuals:
Printable datasheet for anti-GRHL3 (ARP39489_P050) antibody
Target Reference:
Ting,S.B., (2003) Biochem. J. 370 (PT 3), 953-962
Publications:

Sakurai, T. et al. Involvement of leucine zipper transcription factor-like protein 1 (Lztfl1) in the attenuation of cognitive impairment by exercise training. Biochem. Biophys. Res. Commun. 416, 125-9 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 22094257

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...