Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP39489_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP39489_P050-FITC Conjugated

ARP39489_P050-HRP Conjugated

ARP39489_P050-Biotin Conjugated

GRHL3 Antibody - C-terminal region (ARP39489_P050)

Catalog#: ARP39489_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB, ChIP
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-101968 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human GRHL3
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 100%; Rat: 93%
Complete computational species homology data Anti-GRHL3 (ARP39489_P050)
Peptide Sequence Synthetic peptide located within the following region: EEVFDALMLKTPDLKGLRNAISEKYGFPEENIYKVYKKCKRGILVNMDNN
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-GRHL3 (ARP39489_P050) antibody is Catalog # AAP39489 (Previous Catalog # AAPP21506)
Datasheets/Manuals Printable datasheet for anti-GRHL3 (ARP39489_P050) antibody
Target Reference Ting,S.B., (2003) Biochem. J. 370 (PT 3), 953-962
Publications

Sakurai, T. et al. Involvement of leucine zipper transcription factor-like protein 1 (Lztfl1) in the attenuation of cognitive impairment by exercise training. Biochem. Biophys. Res. Commun. 416, 125-9 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 22094257

Gene Symbol GRHL3
Official Gene Full Name Grainyhead-like 3 (Drosophila)
Alias Symbols SOM, TFCP2L4
NCBI Gene Id 57822
Protein Name Grainyhead-like protein 3 homolog
Description of Target GRHL3 is a member of the grainyhead family of transcription factors. GRHL3 interacts with leader-binding protein 32 (LBP-32) and brother of mammalian grainyhead (BOM), and may function as a transcription factor during development. Multiple transcript variants encoding distinct isoforms have been identified for this gene. This gene encodes a member of the grainyhead family of transcription factors. The encoded protein interacts with leader-binding protein 32 (LBP-32) and brother of mammalian grainyhead (BOM), and may function as a transcription factor during development. Multiple transcript variants encoding distinct isoforms have been identified for this gene. Additional transcript variants have been described, but their biological nature has not been determined.
Swissprot Id Q8TE85-4
Protein Accession # NP_937817
Nucleotide Accession # NM_198174
Protein Size (# AA) 509
Molecular Weight 57kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express GRHL3.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express GRHL3.
Protein Interactions PRMT6; PRMT5; PRMT1; GRHL1; GRHL3; GRHL2;
  1. What is the species homology for "GRHL3 Antibody - C-terminal region (ARP39489_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat".

  2. How long will it take to receive "GRHL3 Antibody - C-terminal region (ARP39489_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GRHL3 Antibody - C-terminal region (ARP39489_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GRHL3 Antibody - C-terminal region (ARP39489_P050)"?

    This target may also be called "SOM, TFCP2L4" in publications.

  5. What is the shipping cost for "GRHL3 Antibody - C-terminal region (ARP39489_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GRHL3 Antibody - C-terminal region (ARP39489_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GRHL3 Antibody - C-terminal region (ARP39489_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "57kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GRHL3 Antibody - C-terminal region (ARP39489_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "GRHL3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GRHL3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GRHL3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GRHL3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GRHL3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GRHL3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GRHL3 Antibody - C-terminal region (ARP39489_P050)
Your Rating
We found other products you might like!