Size:100 ul
$319.00
In stock
SKU
ARP33196_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP33196_P050-FITC Conjugated

ARP33196_P050-HRP Conjugated

ARP33196_P050-Biotin Conjugated

GRHL3 Antibody - C-terminal region (ARP33196_P050)

Catalog#: ARP33196_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, ChIP, IHC
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-101968 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human GRHL3
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 92%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 92%
Complete computational species homology data Anti-GRHL3 (ARP33196_P050)
Peptide Sequence Synthetic peptide located within the following region: SGVKGCLLSGFRGNETTYLRPETDLETPPVLFIPNVHFSSLQRSGGAAPS
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-GRHL3 (ARP33196_P050) antibody is Catalog # AAP33196 (Previous Catalog # AAPP04233)
Datasheets/Manuals Printable datasheet for anti-GRHL3 (ARP33196_P050) antibody
Target Reference Ting,S.B., et al., (2003) Biochem. J. 370 (PT 3), 953-962
Publications

Yu, Z., Mannik, J., Soto, A., Lin, K. K. & Andersen, B. The epidermal differentiation-associated Grainyhead gene Get1/Grhl3 also regulates urothelial differentiation. EMBO J. 28, 1890-903 (2009). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 19494835

Gene Symbol GRHL3
Official Gene Full Name Grainyhead-like 3 (Drosophila)
Alias Symbols SOM, TFCP2L4
NCBI Gene Id 57822
Protein Name Grainyhead-like protein 3 homolog
Description of Target GRHL3 is a member of the grainyhead family of transcription factors. GRHL3 interacts with leader-binding protein 32 (LBP-32) and brother of mammalian grainyhead (BOM), and may function as a transcription factor during development. Multiple transcript variants encoding distinct isoforms have been identified for this gene. This gene encodes a member of the grainyhead family of transcription factors. The encoded protein interacts with leader-binding protein 32 (LBP-32) and brother of mammalian grainyhead (BOM), and may function as a transcription factor during development. Multiple transcript variants encoding distinct isoforms have been identified for this gene. Additional transcript variants have been described, but their biological nature has not been determined.
Swissprot Id Q8TE85-4
Protein Accession # NP_937817
Nucleotide Accession # NM_198174
Protein Size (# AA) 509
Molecular Weight 57kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express GRHL3.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express GRHL3.
Protein Interactions PRMT6; PRMT5; PRMT1; GRHL1; GRHL3; GRHL2;
Write Your Own Review
You're reviewing:GRHL3 Antibody - C-terminal region (ARP33196_P050)
Your Rating