Catalog No: ARP39635_P050
Price: $0.00
SKU
ARP39635_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-GRHL2 (ARP39635_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: Human Prostate: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Human Prostate: Formalin-Fixed, Paraffin-Embedded (FFPE)
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human GRHL2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: VEKIAKLYKKSKKGILVNMDDNIIEHYSNEDTFILNMESMVEGFKVTLME
Concentration0.5 mg/ml
Blocking PeptideFor anti-GRHL2 (ARP39635_P050) antibody is Catalog # AAP39635 (Previous Catalog # AAPP21655)
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
ReferenceVan (2008) Hum. Mol. Genet. 17 (2), 159-169
Gene SymbolGRHL2
Gene Full NameGrainyhead-like 2 (Drosophila)
Alias SymbolsBOM, ECTDS, PPCD4, DFNA28, TFCP2L3
NCBI Gene Id79977
Protein NameGrainyhead-like protein 2 homolog
Description of TargetGRHL2 is a transcription factor that can act as a homodimer or as a heterodimer with either GRHL1 or GRHL3. Defects in this gene are a cause of non-syndromic sensorineural deafness autosomal dominant type 28 (DFNA28).TFCP2L3 is a member of a family of transcription factor genes whose archetype is TFCP2 (MIM 189889), a mammalian ortholog of the Drosophila gene 'grainyhead' (grh).[supplied by OMIM]. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because transcript sequence consistent with the reference genome assembly was not available for all regions of the RefSeq transcript. The extent of this transcript is supported by transcript alignments.
Uniprot IDQ6ISB3
Protein Accession #NP_079191
Nucleotide Accession #NM_024915
Protein Size (# AA)625
Molecular Weight71 kDa
Protein InteractionsLMO4; APP; GRHL3;
  1. What is the species homology for "GRHL2 Antibody - middle region (ARP39635_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "GRHL2 Antibody - middle region (ARP39635_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GRHL2 Antibody - middle region (ARP39635_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GRHL2 Antibody - middle region (ARP39635_P050)"?

    This target may also be called "BOM, ECTDS, PPCD4, DFNA28, TFCP2L3" in publications.

  5. What is the shipping cost for "GRHL2 Antibody - middle region (ARP39635_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GRHL2 Antibody - middle region (ARP39635_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GRHL2 Antibody - middle region (ARP39635_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "71 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GRHL2 Antibody - middle region (ARP39635_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "GRHL2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GRHL2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GRHL2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GRHL2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GRHL2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GRHL2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GRHL2 Antibody - middle region (ARP39635_P050)
Your Rating
We found other products you might like!