GRB2 Antibody - C-terminal region (ARP97666_P050)

Catalog No: ARP97666_P050

Host: Rabbit
Target Name: GRB2
Sample Tissue: Human K562 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GRB2
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: ALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GRB2 (ARP97666_P050) antibody is Catalog # AAP97666

Target Info

• Gene Symbol: GRB2
• Gene Full Name: growth factor receptor bound protein 2
• Alias Symbols: ASH, Grb3-3, MST084, NCKAP2, MSTP084, EGFRBP-GRB2
• NCBI Gene Id: 2885
• Protein Name: growth factor receptor-bound protein 2
• Description of Target: The protein encoded by this gene binds the epidermal growth factor receptor and contains one SH2 domain and two SH3 domains. Its two SH3 domains direct complex formation with proline-rich regions of other proteins, and its SH2 domain binds tyrosine phosphorylated sequences. This gene is similar to the Sem5 gene of C.elegans, which is involved in the signal transduction pathway. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Uniprot ID: P62993
• Protein Accession #: NP_002077.1
• Nucleotide Accession #: NM_002086.4
• Protein Size (# AA): 217
• Molecular Weight: 25 kDa