GPX5 Recombinant Protein (Pig) (OPCA04545)

Catalog No: OPCA04545

Product Info

• Predicted Species Reactivity: Porcine|Sus scrofa
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Sus scrofa (Pig)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: NSNLEKMDCYKDVTGTIYDYDAFTLNGNEHIQFKQYAGKHVLFVNVATYCGLTAQYPELNTLQEELKPFGLVVLGFPCNQFGKQEPGENSEILLGLKYVRPGGGYVPNFQLFEKGDVNGEKEQKVFTFLKHSCPHPSELIGSIGYISWEPIRVHDIRWNFEKFLVGPDGVPVMRWVHETPISTVKSDILAYLKQFKTE
• Protein Sequence: NSNLEKMDCYKDVTGTIYDYDAFTLNGNEHIQFKQYAGKHVLFVNVATYCGLTAQYPELNTLQEELKPFGLVVLGFPCNQFGKQEPGENSEILLGLKYVRPGGGYVPNFQLFEKGDVNGEKEQKVFTFLKHSCPHPSELIGSIGYISWEPIRVHDIRWNFEKFLVGPDGVPVMRWVHETPISTVKSDILAYLKQFKTE
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yeast
• Protein Range: 22-219 aa
• Tag: N-terminal 6xHis-tagged and C-terminal Myc-tagged

Target Info

• Reference: Molecular cloning and characterization of the epididymis-specific glutathione peroxidase-like protein secreted in the porcine epididymal fluid.Okamura N., Iwaki Y., Hiramoto S., Tamba M., Bannai S., Sugita Y., Syntin P., Dacheux F., Dacheux J.-L.Biochim. Biophys. Acta 1336:99-109(1997)
• Gene Symbol: GPX5
• Gene Full Name: glutathione peroxidase 5
• Alias Symbols: EGLP;epididymal secretory glutathione peroxidase;epididymis-specific glutathione peroxidase 23kDa subunit;epididymis-specific glutathione peroxidase-like protein;Glutathione peroxidase 5;glutathione peroxidase 5 (epididymal androgen-related protein);GPx-5;GSHPx-5.
• NCBI Gene Id: 396920
• Protein Name: Epididymal secretory glutathione peroxidase
• Description of Target: May constitute a glutathione peroxidase-like protective system against peroxide damage in sperm membrane lipids. Since the purified porcine enzyme has very little activity towards hydrogen peroxide or organic hydroperoxides the protective effect is not likely to be exerted by its enzymatic activity. Instead, may protect sperm from premature acrosome reaction in the epididymis by binding to lipid peroxides, which might otherwise interact with phospholipase A2 and induce the acrosome reaction.
• Uniprot ID: O18994
• Protein Accession #: NP_999051
• Nucleotide Accession #: NM_213886
• Protein Size (# AA): Recombinant
• Molecular Weight: 26.1 kDa