ANTIBODY AND ELISA PROMOS

20% off all ELISAs • Two for the price of one on select antibodies.

Don’t miss out on these great offers! Learn More Here.

Catalog No: ARP58473_P050
Price: $0.00
SKU
ARP58473_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-GPX4 (ARP58473_P050) antibody
Product Info
Tested Species ReactivityHuman, Rat
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Goat, Guinea Pig, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: Human heart (formalin-fixed, paraffin-embedded) stained with GPX4 antibody ARP58473_P050 at 5 ug/ml after heat-induced antigen retrieval
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human GPX4
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Goat: 86%; Guinea Pig: 86%; Human: 100%; Mouse: 86%; Rat: 86%; Yeast: 93%; Zebrafish: 86%
Peptide SequenceSynthetic peptide located within the following region: QUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAA
Concentration0.5 mg/ml
Blocking PeptideFor anti-GPX4 (ARP58473_P050) antibody is Catalog # AAP58473 (Previous Catalog # AAPP34569)
Sample Type Confirmation

GPX4 is supported by BioGPS gene expression data to be expressed in HepG2

Enhanced Validation
WBY
SPR
YCHAROS
ReferencePeters,U., (2008) Cancer Epidemiol. Biomarkers Prev. 17 (5), 1144-1154
Gene SymbolGPX4
Gene Full NameGlutathione peroxidase 4
Alias SymbolsMCSP, SMDS, GPx-4, PHGPx, snGPx, GSHPx-4, snPHGPx
NCBI Gene Id2879
Protein NamePhospholipid hydroperoxide glutathione peroxidase, mitochondrial
Description of TargetGlutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, experimental evidence for alternative splicing exists; alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified.Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, experimental evidence for alternative splicing exists; alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified.
Uniprot IDP36969
Protein Accession #NP_002076
Nucleotide Accession #NM_002085
Protein Size (# AA)197
Molecular Weight19 kDa
Protein InteractionsUBC; PRDX6; MAPK13; OTUD5;
  1. What is the species homology for "GPX4 Antibody - middle region (ARP58473_P050)"?

    The tested species reactivity for this item is "Human, Rat". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Goat, Guinea Pig, Yeast, Zebrafish".

  2. How long will it take to receive "GPX4 Antibody - middle region (ARP58473_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GPX4 Antibody - middle region (ARP58473_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GPX4 Antibody - middle region (ARP58473_P050)"?

    This target may also be called "MCSP, SMDS, GPx-4, PHGPx, snGPx, GSHPx-4, snPHGPx" in publications.

  5. What is the shipping cost for "GPX4 Antibody - middle region (ARP58473_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GPX4 Antibody - middle region (ARP58473_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GPX4 Antibody - middle region (ARP58473_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "19 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GPX4 Antibody - middle region (ARP58473_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "GPX4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GPX4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GPX4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GPX4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GPX4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GPX4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GPX4 Antibody - middle region (ARP58473_P050)
Your Rating
We found other products you might like!