GPX4 Antibody - middle region (ARP58473_P050)

Catalog No: ARP58473_P050

GPX4 antibody - middle region (ARP58473_P050) validated by WB using HepG2 cell lysate at 1.0ug/ml.GPX4 is supported by BioGPS gene expression data to be expressed in HepG2

Immunohistochemistry with Rat Brain lysate tissue

Immunohistochemistry with formalin-fixed, paraffin-embedded human Heart tissue at an antibody concentration of 5.0ug/ml using anti-GPX4 antibody (ARP58473_P050)

Product Info

• Tested Species Reactivity: Human, Rat
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Goat, Guinea Pig, Yeast, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Additional Information: IHC Information: Human heart (formalin-fixed, paraffin-embedded) stained with GPX4 antibody ARP58473_P050 at 5 ug/ml after heat-induced antigen retrieval
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GPX4
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Goat: 86%; Guinea Pig: 86%; Human: 100%; Mouse: 86%; Rat: 86%; Yeast: 93%; Zebrafish: 86%
• Peptide Sequence: Synthetic peptide located within the following region: QUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GPX4 (ARP58473_P050) antibody is Catalog # AAP58473 (Previous Catalog # AAPP34569)
• Sample Type Confirmation:

  GPX4 is supported by BioGPS gene expression data to be expressed in HepG2

• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

Target Info

• Reference: Peters,U., (2008) Cancer Epidemiol. Biomarkers Prev. 17 (5), 1144-1154
• Gene Symbol: GPX4
• Gene Full Name: Glutathione peroxidase 4
• Alias Symbols: MCSP, SMDS, GPx-4, PHGPx, snGPx, GSHPx-4, snPHGPx
• NCBI Gene Id: 2879
• Protein Name: Phospholipid hydroperoxide glutathione peroxidase, mitochondrial
• Description of Target: Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, experimental evidence for alternative splicing exists; alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified.Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, experimental evidence for alternative splicing exists; alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified.
• Uniprot ID: P36969
• Protein Accession #: NP_002076
• Nucleotide Accession #: NM_002085
• Protein Size (# AA): 197
• Molecular Weight: 19 kDa
• Protein Interactions: UBC; PRDX6; MAPK13; OTUD5;