Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: OPCA21189
Price: $0.00
SKU
OPCA21189
Availability: Domestic: within 4-8 weeks delivery International: 4-8 weeks
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

Protein on Demand™ GPX3 Recombinant Protein (Mouse) (OPCA21189)

Datasheets/ManualsPrintable datasheet for OPCA21189
Product Info
Predicted Species ReactivityMouse
Product FormatLiquid
ApplicationWB, ELISA
Reconstitution and StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
PurityGreater than 85% as determined by SDS-PAGE.
Protein SequenceQEKSKTDCHGGMSGTIYEYGALTIDGEEYIPFKQYAGKYILFVNVASYUGLTDQYLELNALQEELGPFGLVILGFPSNQFGKQEPGENSEILPSLKYVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTAELLGSPGRLFWEPMKIHDIRWNFEKFLVGPDGIPVMRWYHRTTVSNVKMDILSYMRRQAALSARGK
Storage BufferTris-based buffer,50% glycerol
Protein Range25-226
Gene Full Nameglutathione peroxidase 3
Alias SymbolsGPx, EGPx, GSHPx-3, GSHPx-P, AA960521
NCBI Gene Id14778
Protein Nameglutathione peroxidase 3
Description of TargetThe protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of organic hydroperoxides and hydrogen peroxide (H2O2) by glutathione, and thereby protect cells against oxidative damage. Several isozy
Uniprot IDP46412
Protein Accession #NP_001316789.1
Nucleotide Accession #NM_001329860.1
Protein Size (# AA)202
Write Your Own Review
You're reviewing:Protein on Demand™ GPX3 Recombinant Protein (Mouse) (OPCA21189)
Your Rating