Catalog No: OPCA21186
Price: $0.00
SKU
OPCA21186
Availability: Domestic: within 4-8 weeks delivery International: 4-8 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for OPCA21186 |
---|
Predicted Species Reactivity | Human |
---|---|
Product Format | Liquid |
Application | WB, ELISA |
Reconstitution and Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Protein Sequence | QSRGQEKSKMDCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYIELNALQEELAPFGLVILGFPCNQFGKQEPGENSEILPTLKYVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTSELLGTSDRLFWEPMKVHDIRWNFEKFLVGPDGIPIMRWHHRTTVSNVKMDILSYMRRQAALGVKRK |
Storage Buffer | Tris-based buffer,50% glycerol |
Protein Range | 21-226 |
Gene Full Name | glutathione peroxidase 3 |
---|---|
Alias Symbols | GPx-P, GSHPx-3, GSHPx-P |
NCBI Gene Id | 2878 |
Protein Name | glutathione peroxidase 3 |
Description of Target | The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of organic hydroperoxides and hydrogen peroxide (H2O2) by glutathione, and thereby protect cells against oxidative damage. Several isozy |
Uniprot ID | P22352 |
Protein Accession # | NP_001316719.1 |
Nucleotide Accession # | NM_001329790.1 |
Protein Size (# AA) | 206 |
Write Your Own Review