GPSM2 Antibody - middle region (ARP91074_P050)

Catalog No: ARP91074_P050

Host: Rabbit
Target Name: GPSM2
Sample Tissue: Mouse Thymus lysates
Antibody Dilution: 1ug/ml

Product Info

• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse GPSM2
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: APSVSVVSPNTDEFLDLLASSQSRRLDDQRASFSNLPGLRLTKGNSPSVL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GPSM2 (ARP91074_P050) antibody is Catalog # AAP91074

Target Info

• Gene Symbol: GPSM2
• Gene Full Name: G-protein signalling modulator 2 (AGS3-like, C. elegans)
• Alias Symbols: L, LGN, Pins, 6230410J09Rik
• NCBI Gene Id: 76123
• Protein Name: G-protein-signaling modulator 2
• Description of Target: Plays an important role in mitotic spindle pole organization via its interaction with NUMA1. Required for cortical dynein-dynactin complex recruitment during metaphase (By similarity). Plays a role in metaphase spindle orientation (By similarity). Plays an important role in asymmetric cell divisions. Has guanine nucleotide dissociation inhibitor (GDI) activity towards G(i) alpha proteins, such as GNAI1 and GNAI3, and thereby regulates their activity.
• Uniprot ID: Q8VDU0
• Protein Accession #: NP_083798.2
• Nucleotide Accession #: NM_029522.2
• Protein Size (# AA): 679
• Molecular Weight: 74 kDa