Search Antibody, Protein, and ELISA Kit Solutions

GPRC5A Antibody - C-terminal region : FITC (ARP75229_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP75229_P050 Unconjugated

ARP75229_P050-HRP Conjugated

ARP75229_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Predicted Species Reactivity:
Human
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality:
Polyclonal
Host:
Rabbit
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Application:
WB
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Gene Symbol:
GPRC5A
Official Gene Full Name:
G protein-coupled receptor class C group 5 member A
NCBI Gene Id:
9052
Protein Name:
retinoic acid-induced protein 3
Swissprot Id:
Q8NFJ5
Protein Accession #:
NP_003970
Alias Symbols:
RAI3, TIG1, RAIG1, GPCR5A, PEIG-1
Description of Target:
This gene encodes a member of the type 3 G protein-coupling receptor family, characterized by the signature 7-transmembrane domain motif. The encoded protein may be involved in interaction between retinoid acid and G protein signalling pathways. Retinoic acid plays a critical role in development, cellular growth, and differentiation. This gene may play a role in embryonic development and epithelial cell differentiation.
Protein Size (# AA):
357
Molecular Weight:
39kDa
Purification:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GPRC5A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GPRC5A.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human RAI3
Peptide Sequence:
Synthetic peptide located within the following region: GFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDYEVKKEGS
Concentration:
0.5 mg/ml
Blocking Peptide:
For anti-GPRC5A (ARP75229_P050-FITC) antibody is Catalog # AAP75229
Datasheets/Manuals:
Printable datasheet for anti-GPRC5A (ARP75229_P050-FITC) antibody
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...