Search Antibody, Protein, and ELISA Kit Solutions

GPM6B Antibody - N-terminal region (ARP44420_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP44420_P050-FITC Conjugated

ARP44420_P050-HRP Conjugated

ARP44420_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
GPM6B
Official Gene Full Name:
glycoprotein M6B
NCBI Gene Id:
2824
Protein Name:
Neuronal membrane glycoprotein M6-b
Swissprot Id:
Q13491
Protein Accession #:
NP_005269
Alias Symbols:
GPM6B, M6B,
Description of Target:
This gene encodes a membrane glycoprotein that belongs to the proteolipid protein family. Proteolipid protein family members are expressed in most brain regions and are thought to be involved in cellular housekeeping functions, such as membrane trafficking and cell-to-cell communication.
Protein Size (# AA):
265
Molecular Weight:
29kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GPM6B.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GPM6B.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human GPM6B
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology data:
Anti-GPM6B (ARP44420_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SGVALFCGCGHVALAGTVAILEQHFSTNASDHALLSEVIQLMQYVIYGIA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
nef; CLN8; ELAVL1; EGFR;
Blocking Peptide:
For anti-GPM6B (ARP44420_P050) antibody is Catalog # AAP44420
Datasheets/Manuals:
Printable datasheet for anti-GPM6B (ARP44420_P050) antibody
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...