Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP44420_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP44420_P050-FITC Conjugated

ARP44420_P050-HRP Conjugated

ARP44420_P050-Biotin Conjugated

GPM6B Antibody - N-terminal region (ARP44420_P050)

Catalog#: ARP44420_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human GPM6B
PurificationAffinity purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology dataAnti-GPM6B (ARP44420_P050)
Peptide SequenceSynthetic peptide located within the following region: SGVALFCGCGHVALAGTVAILEQHFSTNASDHALLSEVIQLMQYVIYGIA
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-GPM6B (ARP44420_P050) antibody is Catalog # AAP44420
Datasheets/ManualsPrintable datasheet for anti-GPM6B (ARP44420_P050) antibody
Target ReferenceN/A
Gene SymbolGPM6B
Official Gene Full Nameglycoprotein M6B
Alias SymbolsGPM6B, M6B,
NCBI Gene Id2824
Protein NameNeuronal membrane glycoprotein M6-b
Description of TargetThis gene encodes a membrane glycoprotein that belongs to the proteolipid protein family. Proteolipid protein family members are expressed in most brain regions and are thought to be involved in cellular housekeeping functions, such as membrane trafficking and cell-to-cell communication.
Swissprot IdQ13491
Protein Accession #NP_005269
Protein Size (# AA)265
Molecular Weight29kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express GPM6B.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express GPM6B.
Protein Interactionsnef; CLN8; ELAVL1; EGFR;
Write Your Own Review
You're reviewing:GPM6B Antibody - N-terminal region (ARP44420_P050)
Your Rating
Assay Development
Aviva Travel Grant
Aviva Tips and Tricks
Aviva Live Chat