Search Antibody, Protein, and ELISA Kit Solutions

GPC4 Antibody - C-terminal region : Biotin (ARP64505_P050-Biotin)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP64505_P050 Unconjugated

ARP64505_P050-FITC Conjugated

ARP64505_P050-HRP Conjugated

Predicted Species Reactivity:
Cow, Guinea Pig, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality:
Polyclonal
Host:
Rabbit
Conjugation:
Biotin
Application:
WB
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Gene Symbol:
GPC4
Official Gene Full Name:
glypican 4
NCBI Gene Id:
2239
Protein Name:
glypican-4
Swissprot Id:
B4E2C0
Protein Accession #:
NP_001439.2
Nucleotide Accession #:
NM_001448.2
Alias Symbols:
K-glypican
Replacement Item:
This antibody may replace item sc-247028 from Santa Cruz Biotechnology.
Description of Target:
Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. The GPC4 gene is adjacent to the 3' end of GPC3 and may also play a role in Simpson-Golabi-Behmel syndrome.
Protein Size (# AA):
486
Molecular Weight:
53kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GPC4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GPC4.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of human GPC4
Predicted Homology Based on Immunogen Sequence:
Cow: 79%; Guinea Pig: 93%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93%
Complete computational species homology data:
Anti-GPC4 (ARP64505_P050)
Peptide Sequence:
Synthetic peptide located within the following region: EYQQCPSEFDYNATDHAGKSANEKADSAGVRPGAQAYLLTVFCILFLVMQ
Concentration:
0.5 mg/ml
Blocking Peptide:
For anti-GPC4 (ARP64505_P050-Biotin) antibody is Catalog # AAP64505
Datasheets/Manuals:
Printable datasheet for anti-GPC4 (ARP64505_P050-Biotin) antibody
Publications:

Walshe, J. & Harkin, D. G. Serial explant culture provides novel insights into the potential location and phenotype of corneal endothelial progenitor cells. Exp. Eye Res. 127, 9-13 (2014). ICC/IF, Human, Rat, Guinea pig, Mouse, Rabbit, Bovine 25035050

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...