Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP64505_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP64505_P050-FITC Conjugated

ARP64505_P050-HRP Conjugated

ARP64505_P050-Biotin Conjugated

GPC4 Antibody - C-terminal region (ARP64505_P050)

Catalog#: ARP64505_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Guinea Pig, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-247028 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of human GPC4
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 79%; Guinea Pig: 93%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93%
Complete computational species homology data Anti-GPC4 (ARP64505_P050)
Peptide Sequence Synthetic peptide located within the following region: EYQQCPSEFDYNATDHAGKSANEKADSAGVRPGAQAYLLTVFCILFLVMQ
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-GPC4 (ARP64505_P050) antibody is Catalog # AAP64505
Datasheets/Manuals Printable datasheet for anti-GPC4 (ARP64505_P050) antibody
Publications

Walshe, J. & Harkin, D. G. Serial explant culture provides novel insights into the potential location and phenotype of corneal endothelial progenitor cells. Exp. Eye Res. 127, 9-13 (2014). WB, Cow, Guinea Pig, Human, Mouse, Rabbit, Rat 25035050

Gene Symbol GPC4
Official Gene Full Name glypican 4
Alias Symbols K-glypican
NCBI Gene Id 2239
Protein Name glypican-4
Description of Target Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. The GPC4 gene is adjacent to the 3' end of GPC3 and may also play a role in Simpson-Golabi-Behmel syndrome.
Swissprot Id B4E2C0
Protein Accession # NP_001439.2
Nucleotide Accession # NM_001448.2
Protein Size (# AA) 486
Molecular Weight 53kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express GPC4.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express GPC4.
Write Your Own Review
You're reviewing:GPC4 Antibody - C-terminal region (ARP64505_P050)
Your Rating