Search Antibody, Protein, and ELISA Kit Solutions

GPC4 Antibody - C-terminal region (ARP64505_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP64505_P050-FITC Conjugated

ARP64505_P050-HRP Conjugated

ARP64505_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Guinea Pig, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
glypican 4
NCBI Gene Id:
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-247028 from Santa Cruz Biotechnology.
Description of Target:
Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. The GPC4 gene is adjacent to the 3' end of GPC3 and may also play a role in Simpson-Golabi-Behmel syndrome.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GPC4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GPC4.
The immunogen is a synthetic peptide directed towards the C-terminal region of human GPC4
Predicted Homology Based on Immunogen Sequence:
Cow: 79%; Guinea Pig: 93%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93%
Complete computational species homology data:
Anti-GPC4 (ARP64505_P050)
Peptide Sequence:
Synthetic peptide located within the following region: EYQQCPSEFDYNATDHAGKSANEKADSAGVRPGAQAYLLTVFCILFLVMQ
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-GPC4 (ARP64505_P050) antibody is Catalog # AAP64505
Printable datasheet for anti-GPC4 (ARP64505_P050) antibody

Walshe, J. & Harkin, D. G. Serial explant culture provides novel insights into the potential location and phenotype of corneal endothelial progenitor cells. Exp. Eye Res. 127, 9-13 (2014). WB, Cow, Guinea Pig, Human, Mouse, Rabbit, Rat 25035050

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...